This notebook contains material from PyRosetta; content is available on Github.

RosettaCarbohydrates: Trees, Selectors and Movers

Keywords: carbohydrate, glycan, glucose, mannose, sugar, ResidueSelector, Mover

Overview

Here, we will cover useful ResidueSelectors and Movers available in the RosettaCarbohdyrate framework. All of these framework components form the basis for the tools you will use in the next tutorial, Glycan Modeling and Design.

Make sure you are in the directory with the pdb files:

cd google_drive/My\ Drive/student-notebooks/

Imports

Before we begin, we must import some specific machinery from Rosetta. Much of these tools are automatically imported when we do from pyrosetta import *, however, some are not. You should get into the habit of importing everything you need. This will get you comfortable with the organization of Rosetta and make it easier to find tools that are beyond the scope of these workshops.

In [ ]:
# Notebook setup
import sys
if 'google.colab' in sys.modules:
    !pip install pyrosettacolabsetup
    import pyrosettacolabsetup
    pyrosettacolabsetup.mount_pyrosetta_install()
    print ("Notebook is set for PyRosetta use in Colab.  Have fun!")
In [1]:
#Python
from pyrosetta import *
from pyrosetta.rosetta import *
from pyrosetta.teaching import *

Intitlialization

Here, we will be opening a PDB file with glycans, so we will use -include_sugars and a few other options that allow us to read (most) PDB files without issue. It is always a good idea to use the GlycanInfoMover to double check that the glycans you are interested in are properly represented by Rosetta. If they are not, post the issue in the Rosetta forums.

Once again, more information on working with glycans can be found at this page: Working With Glycans

PDB vs Rosetta sugar format

Unfortunately, there are few standards in the PDB for how saccharide residues in .pdb files should be numbered and named. The Rosetta code — with the appropriate flags initialization flags, such as -alternate_3_letter_codes pdb_sugar tries its best to interpret .pdb files with sugars, but because of ambiguity and inconsistency, success is in no way ensured. See http://www.rosettacommons.org/docs/latest/rosetta_basics/preparation/Preparing-PDB-files-for-non-peptide-polymers for more info

To guarantee that one can model the specific saccharide system desired unabiguously, Rosetta uses a slightly modified .pdb format for importing carbohydrate residues. The key difference in formats involves the HETNAM record of the PDB format. The standard PDB HETNAM record line:</p>

HETNAM GLC ALPHA-D-GLUCOSE

...means that all GLC 3-letter codes in the entire file are α-d-glucose, which is insufficient, as this could mean several different α-d-glucoses, depending on the ring form and on the main-chain connectivity of the glycan — and many, many more if one includes modified sugars! The modified Rosetta-ready PDB HETNAM record line:</p>

HETNAM Glc A 1 ->4)-alpha-D-Glcp

...means that the GLC residue specifically at position A1 requires the ->4)-alpha-D-Glcp ResidueType or any of its VariantTypes. (Note also that Rosetta uses sentence case 3-letter-codes for sugars.)</p>

Rosetta will output and input with this default format. We use -alternate_3_letter_codes pdb_sugar to read in the PDB-format sugar and -write_glycan_pdb_codes to output the PDB format since we will be working with a structure directly from the PDB.

In [2]:
options = """
-ignore_unrecognized_res
-include_sugars
-auto_detect_glycan_connections
-maintain_links 
-alternate_3_letter_codes pdb_sugar
-write_glycan_pdb_codes
-ignore_zero_occupancy false 
-load_PDB_components false
-no_fconfig
"""
In [3]:
init(" ".join(options.split('\n')))
PyRosetta-4 2019 [Rosetta PyRosetta4.Release.python36.mac 2019.39+release.93456a567a8125cafdf7f8cb44400bc20b570d81 2019-09-26T14:24:44] retrieved from: http://www.pyrosetta.org
(C) Copyright Rosetta Commons Member Institutions. Created in JHU by Sergey Lyskov and PyRosetta Team.
core.init: Rosetta version: PyRosetta4.Release.python36.mac r233 2019.39+release.93456a567a8 93456a567a8125cafdf7f8cb44400bc20b570d81 http://www.pyrosetta.org 2019-09-26T14:24:44
core.init: command: PyRosetta -ignore_unrecognized_res -include_sugars -auto_detect_glycan_connections -maintain_links -alternate_3_letter_codes pdb_sugar -write_glycan_pdb_codes -ignore_zero_occupancy false -load_PDB_components false -no_fconfig -database /Users/jadolfbr/Library/Python/3.6/lib/python/site-packages/pyrosetta-2019.39+release.93456a567a8-py3.6-macosx-10.6-intel.egg/pyrosetta/database
basic.random.init_random_generator: 'RNG device' seed mode, using '/dev/urandom', seed=329193242 seed_offset=0 real_seed=329193242
basic.random.init_random_generator: RandomGenerator:init: Normal mode, seed=329193242 RG_type=mt19937
In [4]:
pose = pose_from_pdb("inputs/glycans/4do4_refined.pdb")
pose_original = pose.clone()
core.chemical.GlobalResidueTypeSet: Finished initializing fa_standard residue type set.  Created 1251 residue types
core.chemical.GlobalResidueTypeSet: Total time to initialize 1.24209 seconds.
core.import_pose.import_pose: File 'inputs/glycans/4do4_refined.pdb' automatically determined to be of type PDB
core.io.util: Automatic glycan connection is activated.
core.io.util: Start reordering residues.
core.io.util: Corrected glycan residue order (internal numbering): [388, 389, 390, 391, 392, 393, 394, 395, 396, 797, 798, 799, 800, 801, 802, 803, 804, 805]
core.io.util: 
core.io.pose_from_sfr.PoseFromSFRBuilder: Setting chain termination for 390
core.io.pose_from_sfr.PoseFromSFRBuilder: Setting chain termination for 394
core.io.pose_from_sfr.PoseFromSFRBuilder: Setting chain termination for 395
core.io.pose_from_sfr.PoseFromSFRBuilder: Setting chain termination for 396
core.io.pose_from_sfr.PoseFromSFRBuilder: Setting chain termination for 798
core.io.pose_from_sfr.PoseFromSFRBuilder: Setting chain termination for 799
core.io.pose_from_sfr.PoseFromSFRBuilder: Setting chain termination for 803
core.io.pose_from_sfr.PoseFromSFRBuilder: Setting chain termination for 804
core.io.pose_from_sfr.PoseFromSFRBuilder: [ WARNING ] Glc388 has an unfavorable ring conformation; the coordinates for this input structure may have been poorly assigned.
core.io.pose_from_sfr.PoseFromSFRBuilder: [ WARNING ] Glc389 has an unfavorable ring conformation; the coordinates for this input structure may have been poorly assigned.
core.io.pose_from_sfr.PoseFromSFRBuilder: [ WARNING ] Man390 has an unfavorable ring conformation; the coordinates for this input structure may have been poorly assigned.
core.io.pose_from_sfr.PoseFromSFRBuilder: [ WARNING ] Glc391 has an unfavorable ring conformation; the coordinates for this input structure may have been poorly assigned.
core.io.pose_from_sfr.PoseFromSFRBuilder: [ WARNING ] Glc392 has an unfavorable ring conformation; the coordinates for this input structure may have been poorly assigned.
core.io.pose_from_sfr.PoseFromSFRBuilder: [ WARNING ] Man393 has an unfavorable ring conformation; the coordinates for this input structure may have been poorly assigned.
core.io.pose_from_sfr.PoseFromSFRBuilder: [ WARNING ] Man394 has an unfavorable ring conformation; the coordinates for this input structure may have been poorly assigned.
core.io.pose_from_sfr.PoseFromSFRBuilder: [ WARNING ] Man395 has an unfavorable ring conformation; the coordinates for this input structure may have been poorly assigned.
core.io.pose_from_sfr.PoseFromSFRBuilder: [ WARNING ] Glc396 has an unfavorable ring conformation; the coordinates for this input structure may have been poorly assigned.
core.io.pose_from_sfr.PoseFromSFRBuilder: [ WARNING ] Glc797 has an unfavorable ring conformation; the coordinates for this input structure may have been poorly assigned.
core.io.pose_from_sfr.PoseFromSFRBuilder: [ WARNING ] Glc798 has an unfavorable ring conformation; the coordinates for this input structure may have been poorly assigned.
core.io.pose_from_sfr.PoseFromSFRBuilder: [ WARNING ] Fuc799 has an unfavorable ring conformation; the coordinates for this input structure may have been poorly assigned.
core.io.pose_from_sfr.PoseFromSFRBuilder: [ WARNING ] Glc800 has an unfavorable ring conformation; the coordinates for this input structure may have been poorly assigned.
core.io.pose_from_sfr.PoseFromSFRBuilder: [ WARNING ] Glc801 has an unfavorable ring conformation; the coordinates for this input structure may have been poorly assigned.
core.io.pose_from_sfr.PoseFromSFRBuilder: [ WARNING ] Man802 has an unfavorable ring conformation; the coordinates for this input structure may have been poorly assigned.
core.io.pose_from_sfr.PoseFromSFRBuilder: [ WARNING ] Man803 has an unfavorable ring conformation; the coordinates for this input structure may have been poorly assigned.
core.io.pose_from_sfr.PoseFromSFRBuilder: [ WARNING ] Man804 has an unfavorable ring conformation; the coordinates for this input structure may have been poorly assigned.
core.io.pose_from_sfr.PoseFromSFRBuilder: [ WARNING ] Glc805 has an unfavorable ring conformation; the coordinates for this input structure may have been poorly assigned.
core.conformation.Conformation: [ WARNING ] missing heavyatom:  OXT on residue LYS:CtermProteinFull 387
core.conformation.Conformation: [ WARNING ] missing heavyatom:  OXT on residue HIS:CtermProteinFull 796
core.chemical.AtomICoor: [ WARNING ] IcoorAtomID::atom_id(): Cannot get atom_id for POLYMER_LOWER of residue ->4)-beta-D-Glcp:2-AcNH 388.  Returning BOGUS ID instead.
core.chemical.AtomICoor: [ WARNING ] IcoorAtomID::atom_id(): Cannot get atom_id for POLYMER_LOWER of residue ->4)-beta-D-Glcp:2-AcNH 391.  Returning BOGUS ID instead.
core.chemical.AtomICoor: [ WARNING ] IcoorAtomID::atom_id(): Cannot get atom_id for POLYMER_LOWER of residue ->3)-alpha-D-Manp:non-reducing_end 395.  Returning BOGUS ID instead.
core.chemical.AtomICoor: [ WARNING ] IcoorAtomID::atom_id(): Cannot get atom_id for POLYMER_LOWER of residue ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396.  Returning BOGUS ID instead.
core.chemical.AtomICoor: [ WARNING ] IcoorAtomID::atom_id(): Cannot get atom_id for POLYMER_LOWER of residue ->4)-beta-D-Glcp:->6)-branch:2-AcNH 797.  Returning BOGUS ID instead.
core.chemical.AtomICoor: [ WARNING ] IcoorAtomID::atom_id(): Cannot get atom_id for POLYMER_LOWER of residue ->3)-alpha-L-Fucp:non-reducing_end 799.  Returning BOGUS ID instead.
core.chemical.AtomICoor: [ WARNING ] IcoorAtomID::atom_id(): Cannot get atom_id for POLYMER_LOWER of residue ->4)-beta-D-Glcp:2-AcNH 800.  Returning BOGUS ID instead.
core.chemical.AtomICoor: [ WARNING ] IcoorAtomID::atom_id(): Cannot get atom_id for POLYMER_LOWER of residue ->3)-alpha-D-Manp:non-reducing_end 804.  Returning BOGUS ID instead.
core.chemical.AtomICoor: [ WARNING ] IcoorAtomID::atom_id(): Cannot get atom_id for POLYMER_LOWER of residue ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805.  Returning BOGUS ID instead.
core.conformation.Conformation: Found disulfide between residues 21 63
core.conformation.Conformation: current variant for 21 CYS
core.conformation.Conformation: current variant for 63 CYS
core.conformation.Conformation: current variant for 21 CYD
core.conformation.Conformation: current variant for 63 CYD
core.conformation.Conformation: Found disulfide between residues 417 459
core.conformation.Conformation: current variant for 417 CYS
core.conformation.Conformation: current variant for 459 CYS
core.conformation.Conformation: current variant for 417 CYD
core.conformation.Conformation: current variant for 459 CYD
core.conformation.Conformation: Found disulfide between residues 25 32
core.conformation.Conformation: current variant for 25 CYS
core.conformation.Conformation: current variant for 32 CYS
core.conformation.Conformation: current variant for 25 CYD
core.conformation.Conformation: current variant for 32 CYD
core.conformation.Conformation: Found disulfide between residues 421 428
core.conformation.Conformation: current variant for 421 CYS
core.conformation.Conformation: current variant for 428 CYS
core.conformation.Conformation: current variant for 421 CYD
core.conformation.Conformation: current variant for 428 CYD
core.conformation.Conformation: Found disulfide between residues 110 141
core.conformation.Conformation: current variant for 110 CYS
core.conformation.Conformation: current variant for 141 CYS
core.conformation.Conformation: current variant for 110 CYD
core.conformation.Conformation: current variant for 141 CYD
core.conformation.Conformation: Found disulfide between residues 506 537
core.conformation.Conformation: current variant for 506 CYS
core.conformation.Conformation: current variant for 537 CYS
core.conformation.Conformation: current variant for 506 CYD
core.conformation.Conformation: current variant for 537 CYD
core.conformation.Conformation: Found disulfide between residues 170 192
core.conformation.Conformation: current variant for 170 CYS
core.conformation.Conformation: current variant for 192 CYS
core.conformation.Conformation: current variant for 170 CYD
core.conformation.Conformation: current variant for 192 CYD
core.conformation.Conformation: Found disulfide between residues 566 588
core.conformation.Conformation: current variant for 566 CYS
core.conformation.Conformation: current variant for 588 CYS
core.conformation.Conformation: current variant for 566 CYD
core.conformation.Conformation: current variant for 588 CYD
core.conformation.carbohydrates.GlycanTreeSet: Setting up Glycan Trees
core.conformation.carbohydrates.GlycanTreeSet: Found 6 glycan trees.

Object Exploration: GlycanTreeSet, CarbohydrateInfo, and the GlycanInfoMover

Before we do anything else, lets get some information on the pose that we are working with.

GlycanTreeSet

The GlycanTreeSet is created when glycans are added to a pose or a pose is created with glycans in it. The GlycanTreeSet has information on each glycan tree and each residue's parent and child. The tree set also has an observer attached to it, so it will auto-update itself when glycan residues are attached or removed from the pose. The GlycanTreeSet is a part of the Pose's Conformation object. First, lets expore this.

Lets find out how many glycan trees are and their lengths.

In [6]:
tree_set = pose.glycan_tree_set()
In [7]:
print(tree_set.n_trees())
6

Ok, so there are 6 glycan trees in our pose! Cool. Lets see what the largest one is:

In [9]:
print(tree_set.get_largest_glycan_tree_length())
5

GlycanTree and GlycanNode

The GlycanTreeSet is made up of GlycanTree objects. Each of these is made up of GlycanNodes for each residue in a tree. Lets expore these.

In [1]:
from IPython.display import Image
Image('./Media/tree_set.png',width='500')
Out[1]:
In [11]:
for start in tree_set.get_start_points():
    print(start, pose.pdb_info().pose2pdb(start), pose.residue_type(start).name3(), pose.residue_type(start).name())
388 501 A  Glc ->4)-beta-D-Glcp:2-AcNH
391 504 A  Glc ->4)-beta-D-Glcp:2-AcNH
396 509 A  Glc ->3)-beta-D-Glcp:non-reducing_end:2-AcNH
797 501 B  Glc ->4)-beta-D-Glcp:->6)-branch:2-AcNH
800 504 B  Glc ->4)-beta-D-Glcp:2-AcNH
805 509 B  Glc ->3)-beta-D-Glcp:non-reducing_end:2-AcNH

Lets look at the parent of each of these glycan start points to see if they are connected to a protein, and if so, what residue they are attached to.

In [12]:
for start in tree_set.get_start_points():
    parent = tree_set.get_parent(start)
    parent_naem = "NONE"
    if parent != 0:
        parent_name = pose.residue_type(parent).name3()
    print(parent, pose.pdb_info().pose2pdb(parent), parent_name)
107 124 A  ASN
160 177 A  ASN
368 385 A  ASN
503 124 B  ASN
556 177 B  ASN
764 385 B  ASN

Cool. So they are all connected to protein residues at an Asparigine. Lets take a look at the first sugar.

In [13]:
tree1 = tree_set.get_tree(388)
In [15]:
print("length", tree1.size())
print("root", tree1.get_root())
length 3
root 107
In [16]:
for res in tree1.get_residues():
    print(res, pose.residue_type(res).name3(), pose.residue_type(res).name())
388 Glc ->4)-beta-D-Glcp:2-AcNH
389 Glc ->4)-beta-D-Glcp:2-AcNH
390 Man ->3)-beta-D-Manp:non-reducing_end

Lets take a closer look at that Mannose, at the end of the tree.

In [19]:
node390 = tree1.get_node(390)
In [23]:
print("n_children", len(node390.get_children()))
print("parent", node390.get_parent())
print("distance", node390.get_distance_to_start())
print("exocylic_connection", node390.has_exocyclic_linkage())
n_children 0
parent 389
distance 2
exocylic_connection False

CarbohydrateInfo

Lets get a bit more information on this particular glycan residue.

In [24]:
info390 = pose.residue_type(390).carbohydrate_info()
In [25]:
info390.anomeric_carbon()
Out[25]:
1
In [38]:
info390.anomeric_carbon_name()
Out[38]:
'C1'
In [28]:
info390.basic_name()
Out[28]:
'mannose'
In [29]:
info390.cyclic_oxygen()
Out[29]:
5
In [30]:
info390.cyclic_oxygen_name()
Out[30]:
' O5 '
In [31]:
info390.full_name()
Out[31]:
'beta-D-mannopyranosyl'
In [32]:
info390.has_mainchain_exocyclic_linkage_to_child()
Out[32]:
False
In [33]:
info390.is_alpha_sugar()
Out[33]:
False
In [34]:
info390.is_amino_sugar()
Out[34]:
False
In [35]:
info390.is_beta_sugar()
Out[35]:
True
In [36]:
info390.is_cyclic()
Out[36]:
True
In [37]:
info390.is_acetylated()
Out[37]:
False

As you can see, the CarbohydrateInfo object of ResidueType provides a great deal of information on this particular sugar. By using the GlycanTreeSet and the CarbohdrateInfo objects, one can delineate nearly everything you wish to know about about a particular tree, glycan, and the connections of them in respect to each other and the whole pose.

GlycanInfoMover

This mover essentially prints much of the connectivity information of a particular pose. It is useful as a first-pass to get general info and to make sure that Rosetta is loading your glycan properly.

Note: You will need to look at the terminal for output of this mover.

In [39]:
from rosetta.protocols.analysis import *
/Library/Frameworks/Python.framework/Versions/3.6/lib/python3.6/site-packages/ipykernel_launcher.py:1: UserWarning: Import of 'rosetta' as a top-level module is deprecated and may be removed in 2018, import via 'pyrosetta.rosetta'.
  """Entry point for launching an IPython kernel.
In [40]:
glycan_info = GlycanInfoMover()
glycan_info.apply(pose)

(Output copied below)

branch Point: ASN 107 124 A 
Branch Point: ASN 160 177 A 
Branch Point: ASN 368 385 A 
Carbohydrate: 388 501 A  Parent: 107 BP: 0 501 A   CON: _->4       DIS: 0 ShortName: ->4)-beta-D-GlcpNAc-
Carbohydrate: 389 502 A  Parent: 388 BP: 0 502 A   CON: _->4       DIS: 1 ShortName: ->4)-beta-D-GlcpNAc-
Carbohydrate: 390 503 A  Parent: 389 BP: 0 503 A   CON:            DIS: 2 ShortName: beta-D-Manp-
Carbohydrate: 391 504 A  Parent: 160 BP: 0 504 A   CON: _->4       DIS: 0 ShortName: ->4)-beta-D-GlcpNAc-
Carbohydrate: 392 505 A  Parent: 391 BP: 0 505 A   CON: _->4       DIS: 1 ShortName: ->4)-beta-D-GlcpNAc-
Carbohydrate: 393 506 A  Parent: 392 BP: 1 506 A   CON: _->3,_->6  DIS: 2 ShortName: ->3)-beta-D-Manp-
Carbohydrate: 394 507 A  Parent: 393 BP: 0 507 A   CON:            DIS: 3 ShortName: alpha-D-Manp-
Carbohydrate: 395 508 A  Parent: 393 BP: 0 508 A   CON:            DIS: 3 ShortName: alpha-D-Manp-
Carbohydrate: 396 509 A  Parent: 368 BP: 0 509 A   CON:            DIS: 0 ShortName: beta-D-GlcpNAc-
Branch Point: ASN 503 124 B 
Branch Point: ASN 556 177 B 
Branch Point: ASN 764 385 B 
Carbohydrate: 797 501 B  Parent: 503 BP: 1 501 B   CON: _->4,_->6  DIS: 0 ShortName: ->4)-beta-D-GlcpNAc-
Carbohydrate: 798 502 B  Parent: 797 BP: 0 502 B   CON:            DIS: 1 ShortName: beta-D-GlcpNAc-
Carbohydrate: 799 503 B  Parent: 797 BP: 0 503 B   CON:            DIS: 1 ShortName: alpha-L-Fucp-
Carbohydrate: 800 504 B  Parent: 556 BP: 0 504 B   CON: _->4       DIS: 0 ShortName: ->4)-beta-D-GlcpNAc-
Carbohydrate: 801 505 B  Parent: 800 BP: 0 505 B   CON: _->4       DIS: 1 ShortName: ->4)-beta-D-GlcpNAc-
Carbohydrate: 802 506 B  Parent: 801 BP: 1 506 B   CON: _->3,_->6  DIS: 2 ShortName: ->3)-beta-D-Manp-
Carbohydrate: 803 507 B  Parent: 802 BP: 0 507 B   CON:            DIS: 3 ShortName: alpha-D-Manp-
Carbohydrate: 804 508 B  Parent: 802 BP: 0 508 B   CON:            DIS: 3 ShortName: alpha-D-Manp-
Carbohydrate: 805 509 B  Parent: 764 BP: 0 509 B   CON:            DIS: 0 ShortName: beta-D-GlcpNAc-
Glycan Residues: 18
Protein BPs: 6
TREES
107 124 A  Length: 3
160 177 A  Length: 5
368 385 A  Length: 1
503 124 B  Length: 3
556 177 B  Length: 5
764 385 B  Length: 1

Branched Connections

Now we can see all of our glycans in the pose, all of their parents, and how all of them are connected to one another. Note residue 803 - here we have two connections. both at carbons 3 and 6. This means we have a branched connection and that residue 802 has two children. A branched connection is always at carbon 6, which is an exocyclic connection. This point has 3 backbone dihedrals instead of our standard two. Lets confirm all of that.

In [50]:
#This is code used to get the branch points in CarbohydrateInfoMover, converted from C++:
def get_connections(localpose, resnum):
    info = localpose.residue(resnum).carbohydrate_info()
    outstring = ""
    attach = "_->"

    if info.mainchain_glycosidic_bond_acceptor():
        outstring = attach + str(info.mainchain_glycosidic_bond_acceptor())
    

    for i in range(1, info.n_branches()+1):
        outstring = outstring + "," +attach + str(info.branch_point( i ))
    
    return outstring;
                   
get_connections(pose, 802)
Out[50]:
'_->3,_->6'
In [52]:
tree802 = tree_set.get_tree_containing_residue(802)
node802 = tree_set.get_node(802)
In [53]:
print("len", tree802.size())
print("children", node802.get_children())
print("exocyclic", node802.has_exocyclic_linkage())
len 5
children vector1_unsigned_long[803, 804]
exocyclic False

Note that 802 doesn't have an exocyclic back to it's parent - however, one of its children has the exocyclic connection back to it. Lets find out which one.

In [54]:
print("exo_803", tree802.get_node(803).has_exocyclic_linkage())
print("exo_804", tree802.get_node(804).has_exocyclic_linkage())
exo_803 False
exo_804 True

Cool. So residue 804 is branched connection. Lets take a closer look.

In [56]:
node804 = tree802.get_node(804)
node803 = tree802.get_node(803)
In [58]:
node802.get_mainchain_child()
Out[58]:
803

MoveMapFactory vs MoveMap creation

Here is something important to note. Rosetta has a concept of the 'mainchain' as it was primarily written for proteins - that are linear in nature. At the deep part of Rosetta, even sugars are denoted as having a 'mainchain'. This mainchain is the 'non-branched' connections. In this case, the mainchain continues onto residue 803, while the 'branch' goes off to residue 804. This is EXTREMELY important to be aware of as MoveMaps have seperate switches for 'branched' torsions. In this way, you should always use the MoveMapFactory which does all this automatically for creating glycan Movemaps or torsions that are branched will not be turned on!!!

After that side-note, lets confirm that there are indeed 3 torsions for the branched connection of residue 802 and 804. Remember that torsions are defined from child TO parent!

In [61]:
from rosetta.core.pose.carbohydrates import *
from rosetta.core.conformation.carbohydrates import *
In [63]:
get_n_glycosidic_torsions_in_res(pose.conformation(), 804)
Out[63]:
3

Great. We have 3. Lets make sure our mainchild child has two.

In [64]:
get_n_glycosidic_torsions_in_res(pose.conformation(), 803)
Out[64]:
2

Awesome. Finally, lets see how many torsions between our first glycan residue of this tree and the ASN. Note that ASN has 3 'chi' angles before glycosylation.

In [68]:
get_n_glycosidic_torsions_in_res(pose.conformation(), tree1.get_start())
Out[68]:
4

After glycosylation, this ASN chi no longer has side-chains to pack. In the packer, they are turned off, as they are now part of the glycan backbone. How does Rosetta know that this should be turned off? Lets see.

In [70]:
protein_res = tree802.get_node(tree802.get_start()).get_parent()
print(protein_res, pose.residue_type(protein_res).name3())
556 ASN
In [71]:
print("Is Branch Point:", pose.residue(protein_res).is_branch_point())
Is Branch Point: True

Ok, Now we can see that this residue is a branch point - meaning that it once again has a mainchain connection that goes onto the the next protein residue, and a branch out to the start of the glycan. Take a look at the rest of the glycan residues. Which are the branch points? Does this info match what the GlycanInfoMover printed?

Glycan Residue Selectors

Now that we have a good idea about the glycans in our pose, lets use some residue selectors that use the underlying tools that we just learned about.

GlycanResidueSelector

The most basic, but useful selector is the GlycanResidueSelector. Here is the description:

A ResidueSelector for carbohydrates and individual carbohydrate trees.
  Selects all Glycan residues if no option is given or the branch going out from the root residue. 
  Selecting from root residues allows you to choose the whole glycan branch or only tips, etc.

All Carbohydrates

First, lets select all carbohydrate residues in the pose.

In [80]:
from rosetta.core.select.residue_selector import *
glycan_selector = GlycanResidueSelector()
all_glycans = glycan_selector.apply(pose)

def print_selection(localpose, selection):
    for i in range(1, localpose.size()+1):
        if selection[i]:
            print(i, localpose.residue_type(i).name3())

print_selection(pose, all_glycans)
388 Glc
389 Glc
390 Man
391 Glc
392 Glc
393 Man
394 Man
395 Man
396 Glc
797 Glc
798 Glc
799 Fuc
800 Glc
801 Glc
802 Man
803 Man
804 Man
805 Glc

Branch Selection

Now lets select a particular glycan tree. We can give either the start of the tree or the connecting protein residue. By default, we do not include the root residue that we pass to the selector. This selection is useful for modeling only a particular glycan tree (or parts of a tree) at a time. It will select all the children and all the children of children/etc. from your selection, out to the tips.

In [82]:
glycan_selector.set_select_from_branch_residue(800)
glycan_selector.set_include_root(True)

print_selection(pose, glycan_selector.apply(pose))
800 Glc
801 Glc
802 Man
803 Man
804 Man

Cool. Now selection from the ASN, but not include the root.

In [83]:
glycan_selector.set_select_from_branch_residue(556)
glycan_selector.set_include_root(False)
print_selection(pose, glycan_selector.apply(pose))
800 Glc
801 Glc
802 Man
803 Man
804 Man

We get the same results. Awesome. This selector can be used in modeling and design tasks in the next tutorial. We can also pass multiple branch residues to select many parts or use the AndSelector as you have seen previously to combine selections. Pass that selector to the MoveMapFactory when doing any minimization or relax.

GlycanLayerSelector

A selector for choosing glycan residues based on their layer - as measured by the residue distance to the start of the glycan tree.

If no layer is set, will select all glycan residues.

This layer selector is used for modeling glycans from their roots out to their trees as you will see in the next tutorial. This definition of 'layer' is useful due to branching and can be used to optimize specific layers at a time.

In [2]:
Image('./Media/tree_layers.png',width='200')
Out[2]:
In [84]:
layer_selector = GlycanLayerSelector()
In [87]:
#Lets select just the first two layers of all the glycans.

layer_selector.set_layer(0, 1)
print_selection(pose, layer_selector.apply(pose))
388 Glc
389 Glc
391 Glc
392 Glc
396 Glc
797 Glc
798 Glc
799 Fuc
800 Glc
801 Glc
805 Glc
In [88]:
#Now lets select only those glycans that have larger layers
layer_selector.set_layer_as_greater_than_or_equal_to(2)
print_selection(pose, layer_selector.apply(pose))
390 Man
393 Man
394 Man
395 Man
802 Man
803 Man
804 Man

Note the residues 802, and children 803 and 804. Both 803 and 804 will have the same layer.

GlycanSequonSelector

So we have some tools for selecting specific glycan residues we are interested in. Now lets change tune a bit. A Sequon is the 3 residue motif recognized by GlycosylTransferase that adds the first glycan onto a protein. There are a few sequon's that are recognized by the glycosylation machinery[N:(not-p):(S or T)], and you can set all or specific ones to use in this selector (via RosettaScripts unfortunately).

We'll cover this more in-depth in the next tutorial, but this selector can be useful for finding potential glycosylation sites in a pose.

Note that the ResidueInSequenceMotifSelector is a general-purpose version of this selector.

In [89]:
sequon_selector = GlycanSequonsSelector()
print_selection(pose, sequon_selector.apply(pose))
core.select.residue_selector.ResidueInSequenceMotifSelector: Use ResidueInSequenceMotifSelector with regular expression
core.select.residue_selector.ResidueInSequenceMotifSelector: searching in: LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKZZZZZZZZZLDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKNLEMSQQHHHHHHZZZZZZZZZ
core.select.residue_selector.ResidueInSequenceMotifSelector: Found motif  (NFT) at sequence position 107
core.select.residue_selector.ResidueInSequenceMotifSelector: searching in: FTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKZZZZZZZZZLDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKNLEMSQQHHHHHHZZZZZZZZZ
core.select.residue_selector.ResidueInSequenceMotifSelector: Found motif  (NAT) at sequence position 160
core.select.residue_selector.ResidueInSequenceMotifSelector: searching in: ATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKZZZZZZZZZLDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKNLEMSQQHHHHHHZZZZZZZZZ
core.select.residue_selector.ResidueInSequenceMotifSelector: Found motif  (NFT) at sequence position 342
core.select.residue_selector.ResidueInSequenceMotifSelector: searching in: FTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKZZZZZZZZZLDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKNLEMSQQHHHHHHZZZZZZZZZ
core.select.residue_selector.ResidueInSequenceMotifSelector: Found motif  (NFT) at sequence position 368
core.select.residue_selector.ResidueInSequenceMotifSelector: searching in: FTVIINPSGVVMWYLYPIKZZZZZZZZZLDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKNLEMSQQHHHHHHZZZZZZZZZ
core.select.residue_selector.ResidueInSequenceMotifSelector: Found motif  (NFT) at sequence position 503
core.select.residue_selector.ResidueInSequenceMotifSelector: searching in: FTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKNLEMSQQHHHHHHZZZZZZZZZ
core.select.residue_selector.ResidueInSequenceMotifSelector: Found motif  (NAT) at sequence position 556
core.select.residue_selector.ResidueInSequenceMotifSelector: searching in: ATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKNLEMSQQHHHHHHZZZZZZZZZ
core.select.residue_selector.ResidueInSequenceMotifSelector: Found motif  (NFT) at sequence position 738
core.select.residue_selector.ResidueInSequenceMotifSelector: searching in: FTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKNLEMSQQHHHHHHZZZZZZZZZ
core.select.residue_selector.ResidueInSequenceMotifSelector: Found motif  (NFT) at sequence position 764
core.select.residue_selector.ResidueInSequenceMotifSelector: Found 8 motifs in sequence.
107 ASN
160 ASN
342 ASN
368 ASN
503 ASN
556 ASN
738 ASN
764 ASN

Note that while 8 motifs were found in th pose, not all are glycosylated - in fact 6/8 are glycosylated from our information from the GlycanInfoMover

RandomGlycanFoliageSelector

This is a simple selector that Selects a random carbohydrate residue from a subset or selector, then selects the rest of the glycan foliage. Used for sampling.

In [114]:
random_foliage = RandomGlycanFoliageSelector()
In [115]:
random_foliage.set_selector(glycan_selector)
print_selection(pose, random_foliage.apply(pose))
801 Glc
802 Man
803 Man
804 Man
In [116]:
print_selection(pose, random_foliage.apply(pose))
396 Glc
In [117]:
print_selection(pose, random_foliage.apply(pose))
804 Man
In [118]:
print_selection(pose, random_foliage.apply(pose))
388 Glc
389 Glc
390 Man

Glycan Movers

Lets do a quick look at some useful glycan-specific movers

LinkageConformerMover

The LinkageConformerMover is an integral part of glycan modeling. This mover puts a 'conformer' of glycan dihedrals into a pose that was identified through a large-scale bioinformatic analysis. A conformer is a well-defined and well-represented set of dihedral angles for a specific linkage. The linkage is specific for different types of sugars in the i and i+1 spot, as well as the specific the i+1 glcyan is connected to on residue i. The mover is useful, but should not be used by itself. You will want a MonteCarlo object, and most likely some packing and minimization to go with it.

In [99]:
from rosetta.protocols.carbohydrates import *
score = get_score_function()
mc = MonteCarlo(pose, score, 4.0)
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.scoring.ScoreFunctionFactory: The -include_sugars flag was used with no sugar_bb weight set in the weights file.  Setting sugar_bb weight to 1.0 by default.
basic.io.database: Database file opened: scoring/score_functions/elec_cp_reps.dat
core.scoring.elec.util: Read 40 countpair representative atoms
core.pack.dunbrack.RotamerLibrary: shapovalov_lib_fixes_enable option is true.
core.pack.dunbrack.RotamerLibrary: shapovalov_lib::shap_dun10_smooth_level of 1( aka lowest_smooth ) got activated.
core.pack.dunbrack.RotamerLibrary: Binary rotamer library selected: /Users/jadolfbr/Library/Python/3.6/lib/python/site-packages/pyrosetta-2019.39+release.93456a567a8-py3.6-macosx-10.6-intel.egg/pyrosetta/database/rotamer/shapovalov/StpDwn_0-0-0/Dunbrack10.lib.bin
core.pack.dunbrack.RotamerLibrary: Using Dunbrack library binary file '/Users/jadolfbr/Library/Python/3.6/lib/python/site-packages/pyrosetta-2019.39+release.93456a567a8-py3.6-macosx-10.6-intel.egg/pyrosetta/database/rotamer/shapovalov/StpDwn_0-0-0/Dunbrack10.lib.bin'.
core.pack.dunbrack.RotamerLibrary: Dunbrack 2010 library took 0.236934 seconds to load from binary
In [100]:
conformer_mover = LinkageConformerMover()
In [103]:
conformer_mover.set_residue_selector(layer_selector)
conformer_mover.set_use_gaussian_sampling(True)
conformer_mover.set_use_conformer_population_stats(False)

pose = pose_original.clone()

for i in range(1, 750):
    conformer_mover.apply(pose)
    print(score.score(pose), mc.boltzmann(pose))

mc.recover_low(pose)
print(score.score(pose_original), score.score(pose))
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1910.365382431397 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
854.641318110847 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1045.7761787311688 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2545.0154096504884 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1918.915579917471 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2681.8649069794983 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2695.3769923291607 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2566.212147479481 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1758.217521190715 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1327.6600191805903 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2224.7749366109488 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2694.011981767933 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1703.259878615133 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-1840.1159198973176 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-846.1683458986738 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
126.65976395729034 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-1196.1240335865698 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
3465.444061302948 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2599.026055634355 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2271.0648429828584 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-991.9222032012237 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1376.0782988773333 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2508.79592599238 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1986.4465841249178 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2295.674480806352 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2639.1161514200967 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1996.5169663977747 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2653.737773416269 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2544.145827042852 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2637.429078150533 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-475.5917746502089 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2674.5487048563823 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2711.6774350173205 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2734.4297496773256 True
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2737.194564488889 True
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1344.0016559310664 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2549.485277790281 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2294.419266943856 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2726.0660116861172 True
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
1283.5458162164223 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-823.6738375252576 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-1362.0825221905932 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2563.6964596661587 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2695.750260589232 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2731.447856982745 True
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
2406.807077021155 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2734.3669871425523 True
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2236.023052896829 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
481.9198345336348 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2735.2107409973914 True
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2362.9543364101587 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2658.022785467104 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2736.5461163083564 True
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2056.8124546063436 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2736.615549335562 True
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
4772.334435133841 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-1288.4602894546413 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-1579.986918110509 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2707.537031088452 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2614.166960488867 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
3357.938867860051 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2648.7243779291357 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-963.5247514655514 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
1771.0278160263254 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2663.1864110126694 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-1859.576956815712 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2584.164747337326 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1009.2151127910397 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-831.2450281260185 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2660.130344570938 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2735.533901030981 True
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2664.69987983202 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2672.6870835533437 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2571.197360735663 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
293.48306414319904 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2732.825893389316 True
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2345.400624441443 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2491.0849029590063 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-1778.804803782924 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2728.913995462654 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2439.7982403530473 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1489.214545614799 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1899.0802747223843 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-400.39072782950996 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-185.56135876662404 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2649.6302045276193 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1967.1254247519528 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-927.5117732780119 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2608.2872446675174 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2737.480388493901 True
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-1665.6320058066224 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2717.084787537817 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2633.1096817423186 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2246.649189877074 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2535.145461710956 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
143.64106547147819 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-1403.2286603143314 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2682.119093508751 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2726.771805497763 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2618.2841505361125 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2663.7886544349594 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1321.5559623290683 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-488.49642196265245 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2438.654617917482 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1245.0142389807131 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2198.836560716656 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2629.6615476770016 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2627.8728300249377 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1496.6694370306768 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2707.6229550217085 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-565.7566577547202 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2637.3106066745536 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1338.068234480923 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2668.3810351205925 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2643.169389006603 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1993.800119523358 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2254.3191303679573 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1412.680882477732 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2374.7937813010803 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
532.0718341117441 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2459.1050384706537 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1726.01352015289 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2271.10176117596 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2629.9490716369555 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2702.2051130659984 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2089.3550323935137 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2119.6612944562385 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1190.1862339001325 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-1438.2584361207303 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2610.6308638400915 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2671.645319655944 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2014.0671940363966 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1121.0137428385585 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2723.815801108259 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
637.3987814061284 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
1811.818705839503 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2018.9009020565502 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
4512.61356462916 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2733.485560186264 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2439.197467583188 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2495.958820251635 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2355.608949419453 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2220.4726630685805 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2687.8286989483095 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2733.85868525879 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2607.7452966959327 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1376.4563416318688 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2738.9523933156042 True
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2252.543663787551 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
1946.946861750728 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2390.458471825667 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1209.247113583235 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2732.2938795174723 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2717.158115968792 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2301.9892567504394 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2322.6243260116617 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-373.2976523146514 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-1913.241733060247 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-249.43697892650405 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1699.3909349343328 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-464.4012713644988 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2734.1252875066516 True
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2516.0017483160573 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2654.3388071781405 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-83.98129894785973 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1523.4862845436462 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2547.44314970726 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1715.9178826332793 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2642.8328695792666 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2729.7823515185432 True
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2690.9259779196427 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2727.7242403579653 True
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2671.8163601522474 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2526.4234188283617 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2627.16064336405 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2632.978130476447 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2191.4095665132454 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2664.5050168399443 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2276.3512440793206 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1958.4239251142894 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2671.8604875336478 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2576.911188039834 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2459.8552534129644 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2699.557496698065 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2109.0361636346474 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2657.353950021329 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2415.722115941066 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2544.732329946222 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2701.224535549045 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1713.7132193404968 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2638.9777708731926 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-14.078755795899099 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1226.5298660714968 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
1540.4188982005187 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2445.741803488389 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2690.895333507487 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
954.4357422403995 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2306.0272812042112 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1484.836177180813 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2340.5654017083148 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
2810.041260927938 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2706.614509653772 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2458.3254225375345 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2622.443011584391 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2654.106021928909 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2261.524417026578 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2707.4593057426414 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2043.7697982197558 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2076.242346810252 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2702.1626037183946 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2463.5527365196967 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2719.0095429426633 True
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
4304.674004848826 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
3424.6249390266435 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
3322.7263170172255 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2723.57314255534 True
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2696.070641037487 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1547.9720060836476 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2168.809918047628 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2647.7873506803317 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2387.1970696937847 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1542.2591203615755 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1162.7831263845808 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1696.8249549372676 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-429.0935063596618 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2719.8065513651622 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2415.301821040847 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1300.4607332527105 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
735.9455468053881 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1913.5016557831198 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2617.772622105922 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1483.076510320365 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2464.389945795775 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-1572.8500493005697 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2380.09589309809 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1860.3043450447244 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
454.2738041901125 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1786.957387117472 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2371.684213263416 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2648.2435223194807 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-428.45147503688804 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2719.213955395027 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1817.6823001581083 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2264.653648323252 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2680.915354733533 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2207.0822767654086 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2181.2684993583466 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2633.1486892369917 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1395.20874899647 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2374.9482905596706 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2687.044358358622 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-1345.8953390866322 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2636.113091817711 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2307.899278636158 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2684.7852971186617 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-975.0421763867291 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2662.3255180353717 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2164.7150861993005 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1952.1275983026624 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2687.8504645744997 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2715.8785185768193 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2137.386681587419 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2116.77358596226 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1809.25113090896 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
931.4946683411893 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2565.472179207365 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2488.22284114687 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2655.777774072302 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2135.516171179935 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2192.752311049513 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2702.9411433603127 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2717.108114618588 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2377.90463227095 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2725.169745045999 True
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-1627.314692593718 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2708.373909344184 True
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
681.1118118384231 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2675.3973858890367 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2626.7929533026286 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2653.554042058363 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2661.886870932676 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-759.9959077991591 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1443.3222100294083 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2613.5773016811777 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2641.7930290533436 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2462.374791767988 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2647.133818449605 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-1265.152246162711 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
300.4366214832168 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2495.5874416478327 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
405.23609014818646 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2667.950488497213 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2692.579122173429 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
782.9565802744143 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
2143.83092438826 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-415.1184187562286 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2722.9861950203285 True
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2674.3323535385443 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-1598.2504708659815 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2702.36121358386 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-102.97366450510899 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1800.8174262929165 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2430.487052271447 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2670.198489416823 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2201.3342509005424 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2406.2994410628985 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2502.972212219978 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2468.31406702608 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2501.4115605001493 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-1598.8210591431446 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2519.5176998445336 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1286.438281153956 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2067.1326950832126 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2495.627791847244 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2616.2541583377533 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2648.681244215614 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1298.5878266766479 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2570.8693227793988 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
1919.6030590460339 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-852.8800795884704 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-732.5119679549865 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-1084.094854053167 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1512.7229588190694 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2711.1336297869907 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2721.2234394645807 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2209.2938516159825 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1442.3859269314146 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2635.487634325189 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2411.9229631977064 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1638.0185302354168 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-1424.3866175844898 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2682.833037400351 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-1995.170684788911 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2725.4064755984573 True
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2692.9679845957808 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2620.7276379005903 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2608.8484459422107 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2531.3734188721023 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2411.6842547914575 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2359.8225384073694 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2133.5859292096966 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2290.4541498845106 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2682.5933220739967 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2336.151440183386 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2711.5797098633975 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2540.338471304796 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-148.38401620343657 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
2723.736158614216 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2534.6947438446314 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2656.227554699915 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2722.577676000016 True
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2546.0458306068986 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2644.2386333327445 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2715.7953202866693 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1376.2753567788473 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2184.054374209926 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1959.3056125758937 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-738.8779575418313 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1236.2649407166682 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2709.6521361250057 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2584.4546558056254 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2488.5315599220753 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2689.9586847734017 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2540.774127359638 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2242.667687669592 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2462.2276452124747 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2662.5688328800825 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2697.3654878568555 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2058.208701131949 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2207.229585546403 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2676.078909812255 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
1141.0783754445515 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2726.779903457142 True
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2585.2473651102737 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
323.63441568688825 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2730.785250430178 True
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2719.128599793818 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2203.3370590307095 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2219.4448688149773 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2457.4045961626653 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2645.3345963386723 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
156.38082606579155 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
771.2298346271876 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1711.3332701563868 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
2009.3640084541437 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-760.9258456067749 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1386.7997521001337 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2704.2931083588496 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1902.8531946258329 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2502.7106014189353 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2691.7838181766133 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2604.263202617372 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2702.6628953940776 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2724.67494324193 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
1876.7850081703189 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
4471.999234299737 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2606.55998382675 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2266.841841190172 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2654.9214270103903 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-201.7339691787209 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2524.529751553688 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-331.2790255937837 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2288.8379077184145 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2714.514863215619 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1665.013450712093 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2669.0929414028114 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2731.613247830894 True
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-883.415600100118 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1742.6709694214105 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2712.8256404562553 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2302.326038988519 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2718.59446546397 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-580.4853535214178 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2727.0013084728066 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2712.5298972267237 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
3193.050679139994 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2683.6133531448186 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1920.0820409844653 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2614.2406782315343 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2417.068920222853 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1198.4777623791638 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2323.6144199063297 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2580.576171219445 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-766.0069770496027 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
2447.5621074827045 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2014.347782657332 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2252.9557579823827 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
960.4959573032944 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1297.6146084135848 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1656.3751488112591 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2646.387600083352 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2611.743378298644 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2331.002324022712 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
370.02278689671493 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2574.5216426703205 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-1086.671271413266 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2733.4585418376487 True
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2510.793271227098 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
765.350368047162 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2710.340001146553 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2693.542597645613 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-327.3044800576405 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
1668.0887952463538 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2731.0508871860866 True
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-4.6439390981659585 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2685.6986360683377 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-600.298747535795 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-1595.2243040873125 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2313.1001607741305 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2430.1101132123367 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1510.8905827457118 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2437.1924082523633 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2699.535174064357 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-1606.0896482300027 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1487.7916707921481 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1961.08628223609 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-826.3781585851873 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2698.921594132647 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2609.003605021033 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2703.9447111964146 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2089.095915804404 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2728.146177968486 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1015.0915152659459 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2632.0168504634353 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2487.2815283933014 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-209.10608642849238 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2712.547720205486 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2169.960629504904 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2214.279140301403 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2728.419982719361 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
1009.0314138191713 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2355.0904718640477 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1722.1428416128363 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1556.9295581339263 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1112.2915417430193 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2603.9609375845944 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2614.8074007346468 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2676.2584387333764 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2594.7948096360074 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2723.1094152051414 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2419.5900316837206 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2383.341845784841 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-523.9330886593679 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-1021.8649621283173 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2701.11692664007 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1257.419329650118 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2718.376629445358 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2731.111747024916 True
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2595.618509297374 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2692.29473165613 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2608.495020703941 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1810.3803333389803 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-536.889660226738 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1990.8806075457376 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2648.9139922048216 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2567.74886262122 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2662.9101215262967 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2650.144752947865 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2627.1917904584143 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2700.6111373495064 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2665.267725084248 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
855.5086062947906 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2726.0684296535337 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2185.289166854551 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2179.646590770541 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-381.222053460394 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
277.3024195054577 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
332.17023190396003 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2623.84515720303 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-711.79010649316 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2478.7850928642742 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2003.145895332316 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2177.668606417343 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2645.789125498105 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2728.6346704349107 True
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2645.3863926783197 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2611.4722189645627 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
1799.8228701116911 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1445.3299571939788 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2603.2274124499745 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2678.099444164925 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2724.5782513922527 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2733.129245263155 True
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
903.15303586541 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2701.751673875811 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1851.1311792580273 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2635.274844614674 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2226.688598021949 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2739.975225525035 True
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2738.9458795513315 True
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2476.813805245517 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-142.2200455480587 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
4665.988893422126 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1481.913686959433 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2557.3225033782683 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2442.2324258936073 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2737.705331253449 True
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1771.3385312182181 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2705.74412843478 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2581.0593178113295 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2394.513469149171 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
3486.3582409636665 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2243.3521159792203 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-676.1832574083326 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-1835.0714774907262 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2276.187046753778 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2329.5969882258355 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
4272.010261885292 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2737.9693876317438 True
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2731.5134342335837 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2280.653404275377 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2043.4694710811734 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2690.441646550163 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2672.893360179811 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2666.516270039796 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-534.7247731814525 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2577.0233260428877 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1432.1077824967108 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2606.317339639357 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2067.9664840324203 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
3949.749170270511 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2579.090747191514 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
78.61853552444185 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2701.1496584394217 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1331.1356907652669 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-887.5077474993017 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2703.279714033692 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-999.2476258638412 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-1468.9054151192854 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2685.3963836992484 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2640.804704049454 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2744.6487307813554 True
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2732.1141093736787 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2618.045051218831 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2632.1375657194953 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-227.42324609010714 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1419.720517078684 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2658.3194928476205 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2736.6765611569413 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2632.6783212604864 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1779.0588313400306 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-801.033001229669 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-346.0981243282298 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-1971.780793133256 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2718.3724762396673 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1545.5006337464542 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
1626.8922356886965 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
158.64409919796074 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2699.06428861876 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2650.2453065417826 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2658.6418906175004 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2588.926443088168 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-1082.6523812643518 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-210.2620357698684 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2451.2096036419252 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2088.8169549983277 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2337.9821111959836 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1010.199217004197 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
3284.9118121843435 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2730.4349060571026 True
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1151.4201750432885 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2385.538171872276 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1596.6796385540629 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2668.833297930253 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2706.3396667691545 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2696.5507921652224 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1194.893850131558 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2393.547799000139 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1858.971168648944 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2110.420212155624 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2680.72749086122 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2263.565046919548 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2248.5610326451792 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2702.185642574932 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2671.854094082005 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2644.2402591172736 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2540.1743312017256 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2097.9139755237757 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2460.422438403102 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2640.002482080857 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1900.2423815626332 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2207.4231541162103 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2312.8823456169507 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1677.0837212219985 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
1084.8101602212982 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1681.266174297937 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
162.59299098791777 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-1557.1014686137294 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
1169.0711862003454 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-871.7819758115025 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2615.350306720846 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
4591.282699282692 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2654.91077573125 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2608.230465068051 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2727.569422796923 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2106.285123409896 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2227.976514724713 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2587.347495266408 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2203.3357932479585 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2513.2022881900843 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2697.5874774893477 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2665.342800723097 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
684.8538571097404 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2534.489600205494 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2262.2187197023463 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2711.171430007914 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1309.7250244881889 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2569.025632128097 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-903.7950488809931 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2713.344059759988 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1239.7817083710258 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2054.868650050348 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2121.2068505322554 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2597.0750692015317 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1958.8180408169487 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1325.0674674336785 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1851.1537580492723 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2653.409564384554 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2717.7003547625072 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2613.7298551263643 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2089.8079988551017 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2227.785183099432 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2222.718512548603 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1976.440347262051 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-1150.9803072830869 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2636.513730273 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
94.82853896493802 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2621.5386120798876 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2076.4778611883726 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2440.223938624688 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2570.0469075423193 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-863.3982122535464 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2202.072237957558 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2737.124887948391 True
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-1987.582664141543 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2527.472901878141 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2466.1834658918556 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
1304.2255363641837 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2666.1213105391557 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
1229.1955391998665 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2691.2951627446205 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2647.815078839801 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2599.0018106534226 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2723.109000670661 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1982.8554310575853 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2684.8178899187947 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2687.3378953085394 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1189.2851918769263 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-1002.7467340590586 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2727.0593821036464 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2228.3672660710217 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-1656.7608395975726 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2648.434841206522 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2720.8772886606166 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2343.1335430436893 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2408.2166347632206 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2279.1133368874584 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1703.0363761416006 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
680.0173577609067 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2714.740268318473 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2551.2148088333697 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2569.2541184190272 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2704.6430472322495 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
3881.1058435424443 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2704.729855465381 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2595.443308064816 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2733.365573351551 True
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2229.431587456744 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-1457.0632728714106 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2505.7850436084273 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-214.03801077859973 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2727.5442688470057 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2706.1013300822215 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1167.78061664291 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2617.1316434994606 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1517.845805990918 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2202.659480178671 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-1777.736373410319 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2588.700516238495 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
630.5587462882427 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2556.949424609764 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-1696.3404648087294 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2606.0294911352257 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2647.647175675389 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2434.895447743156 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2597.129852121379 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2456.733468937899 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2013.9490645887024 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2629.3199600646894 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2609.7773991153376 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
1108.8943294530143 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2538.55997544967 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
197.44168048460543 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2322.753062870455 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2644.1997167452682 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2730.361157402887 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2061.5751768698633 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 2 which has a population of 0.4401
protocols.carbohydrates.LinkageConformerMover: Complete
-2342.029064090047 False
protocols.carbohydrates.LinkageConformerMover: Sampling beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2415.7827233981334 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2687.848157382291 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-2106.3521701289533 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2265.781906554375 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->6)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 0.5599
protocols.carbohydrates.LinkageConformerMover: Complete
-1216.0935827871772 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
3092.803028055262 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2017.635427564597 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2605.601175434784 False
protocols.carbohydrates.LinkageConformerMover: Sampling alpha-D-Manp-(?->3)-beta-D-Manp- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-811.9149204988624 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-2524.980486887603 False
protocols.carbohydrates.LinkageConformerMover: Sampling ->3)-beta-D-Manp-(?->4)-beta-D-GlcpNAc- linkage
protocols.carbohydrates.LinkageConformerMover: Sampling conformer 1 which has a population of 1
protocols.carbohydrates.LinkageConformerMover: Complete
-862.6946075611348 False
-2745.382718468612 -2747.190836830063

Did we find a better conformer? Did our energy decrease even in a pre-refined pose? It should be noted that we use guassian sampling to sample around the gaussian using the standard deviation and mean of each dihedral in the conformer. Otherwise, we just use the mean. This gives some variance in our conformers.

Use the RMSDMetric and the LayerSelector and GlycanLayerSelector to calculate the RMSD of change of the pose relative to the original_pose. Take a look in PyMol. How much has it changed?

Correcting Structures

TautomerizeAnomerMover

This mover is useful when solving structures of glycans or fixing errors in PDB files. Here is the description:

A Mover class for tautomerizing from one anomer to another at a reducing end.

@details

This carbohydrate-specific Mover randomly selects a free reducing end (not a glycoside) and inverts the stereochemistry, swapping alpha anomers for beta and beta for alpha. (This could be considered an extremely limited design case; however, reducing ends readily tautomerize in solution, in contrast to other cases, in which residues do not readily mutate into others!)

It is generally not certain which form is preferred (if any) in sugar-binding proteins, and crystal structures sometimes arbitrarily assign one anomer over another when fitting density, so this Mover can assure that each anomer is sampled. If a ResidueSelector is set, the Mover will select from the subset at random; it will not guarantee tautomerization of every Residue in the subset.

In this case, all of our residues are lower termini, as they are all connected to proteins - so this mover doesn't do anything for us - but if you had free glycans, you could use this here.

In [110]:
glycan_selector = GlycanResidueSelector()

tautomerize_mover = TautomerizeAnomerMover()
tautomerize_mover.selector(glycan_selector)


pose = pose_original.clone()

tautomerize_mover.apply(pose)
protocols.carbohydrates.TautomerizeAnomerMover: Mover name: TautomerizeAnomerMover, Mover type: TautomerizeAnomerMover, Mover current tag:NoTag
protocols.carbohydrates.TautomerizeAnomerMover: Getting movable residues....
protocols.carbohydrates.TautomerizeAnomerMover: [ WARNING ] There are no movable residues available in the given pose.

IdealizeAnomericHydrogens

This mover was references in Frenz, et al - Automatically fixing errors in carbohydrate structures. Referenced in the previous tutorial. It is used to idealize anomeric hydrogens, which sometimes can be quite wrong in structures or not well optimized. Since our input structure was actually refined through cartesian relax into the crystal density, the hydrogens should already be idealized.

In [111]:
pose = pose_original.clone()
idealize_anomeric_hs = IdealizeAnomericHydrogens()
idealize_anomeric_hs.apply(pose)

print(score.score(pose_original), score.score(pose))
-2745.382718468612 -2745.1021866545157

RingPlaneFlipMover

https://www.rosettacommons.org/docs/latest/scripting_documentation/RosettaScripts/Movers/movers_pages/carbohydrates/RingPlaneFlipMover

Based on a given ResidueSelector and limited by a MoveMap, this Mover selects applicable cyclic residues and performs a 180-degree shearing move in which the anomeric bond and the main-chain bond on the opposite side of the ring are moved in opposite directions. An "applicable" residue is limited to 1,4-linked aldopyranoses or 2,5-linked ketopyranoses for which both the anomeric bond and the glycosidic linkage bond are equatorial.

This Mover is useful in cases — for example, when working with highly charged and sulfated heparins — where Rosetta models an oligo- or polysaccharide in such a way that the residue is sitting in the relatively correct position but is missing favorable interactions that it could make on the other side of the glycan ring. Sometimes, a simple "ring flip" could correct this, but the energy barrier to rotate is too high; the small moves of a ShearMover would never flip the ring around.

In [112]:
ring_flipper = RingPlaneFlipMover()

pose = pose_original.clone()
mc = MonteCarlo(pose, score, 4.0)

for i in range(1, 200):
    ring_flipper.apply(pose)
    print(score.score(pose), mc.boltzmann(pose))

mc.recover_low(pose)
print(score.score(pose_original), score.score(pose))
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 801
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1430.5603589410046 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2659.553033740821 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of a terminal residue off residue 0
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2186.408737442011 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 392
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-1713.1913250798432 False
protocols.carbohydrates.RingPlaneFlipMover: Mover name: RingPlaneFlipMover, Mover type: RingPlaneFlipMover, Mover current tag:NoTag
protocols.carbohydrates.RingPlaneFlipMover: Getting movable torsions....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 388 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 389 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Manp:non-reducing_end 390 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 391 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 392 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 394 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 395 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 396 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 798 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-L-Fucp:non-reducing_end 799 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 800 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->4)-beta-D-Glcp:2-AcNH 801 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 803 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-alpha-D-Manp:non-reducing_end 804 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Checking if ->3)-beta-D-Glcp:non-reducing_end:2-AcNH 805 can flip....
protocols.carbohydrates.RingPlaneFlipMover: Applying RingPlaneFlipMover to pose....
protocols.carbohydrates.RingPlaneFlipMover: Flipping ring plane of residue 389
protocols.carbohydrates.RingPlaneFlipMover: Move(s) complete.
-2089.6235050276614 False
-2745.382718468612 -2745.382718468611

Glycosylation

Glycosylation can be performed by either a function as you have seen in the previous tutorial, or through a mover, the SimpleGlycosylateMover. This mover is covered in the next tutorial

BB Sampling

Here, we will cover a few more components of glycan sampling, without the modeling movers covered in the next section

GlycanTreeMinMover

The GlycanTreeMinMover is useful as it randomly selects a glycan tree and a residue in the glycan tree set to move through a movemap, and then minimizes the rest of glycan foliage. Underneath the hood, it uses the RandomGlycanFoliageSelector.

In [119]:
foliage_min = GlycanTreeMinMover(glycan_selector)
foliage_min.apply(pose)
protocols.carbohydrates.GlycanTreeMinMover: Minimizing from carbohydrate root: 390
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.scoring.ScoreFunctionFactory: The -include_sugars flag was used with no sugar_bb weight set in the weights file.  Setting sugar_bb weight to 1.0 by default.
protocols.carbohydrates.GlycanTreeMinMover: Minimizing 1 residues
In [120]:
foliage_min.apply(pose)
protocols.carbohydrates.GlycanTreeMinMover: Minimizing from carbohydrate root: 799
protocols.carbohydrates.GlycanTreeMinMover: Minimizing 1 residues
In [121]:
foliage_min.apply(pose)
protocols.carbohydrates.GlycanTreeMinMover: Minimizing from carbohydrate root: 801
protocols.carbohydrates.GlycanTreeMinMover: Minimizing 4 residues

BBSampler: SugarBBSampler

Since glycans can have 2-4+ dihedral angles, a new way to sample specific backbone residues was created. This is the BBSampler framework. It is also integrated into the GlycanModeler covered in the next chapter.

The SugarBBSampler works by using the sugar_bb energy term as probabilities for each dihedral of each linkage type and using them for sampling.

Note that we could sample on omega as well, and we can give the sampler a mask using the function set_dihedral_mask() that tells it which residues have which dihedrals to sample. For now, we'll just sample phi and psi.

In [126]:
from rosetta.protocols.simple_moves import *
from rosetta.protocols.simple_moves.bb_sampler import *
from rosetta.core.id import *
In [127]:
sampler = BBDihedralSamplerMover()
sugar_bb_phi = SugarBBSampler(phi_dihedral)
sugar_bb_psi = SugarBBSampler(psi_dihedral)
In [130]:
#We include from residue 801, as there is no sugarbb data for the ASN-glycan linkage.  
glycan_selector.set_select_from_branch_residue(801)
glycan_selector.set_include_root(True)

sampler.add_sampler(sugar_bb_phi)
sampler.add_sampler(sugar_bb_psi)
sampler.set_residue_selector(glycan_selector)
for i in range(1, 300):
    sampler.apply(pose)
    print(score.score(pose), mc.boltzmann(pose))

mc.recover_low(pose)
print(score.score(pose_original), score.score(pose))
-2752.1656836052152 True
-2751.872132630229 True
-2724.177841316109 False
-2751.842261395654 True
-2746.9076845786617 True
-2751.584806673987 True
-2750.506148444401 False
-2747.944979626023 False
-2749.335104459393 False
-2747.689031617554 False
-2751.5330227515274 True
-2741.8592555546898 False
-2751.483368861345 True
-2750.7269310194156 True
-2407.66734288903 False
-2751.372870640863 True
-2671.2526794406403 False
-2751.3406820699265 True
-2750.517030538459 True
-2749.56644096143 True
-2748.7371259057127 True
-2690.171369191909 False
-2748.5632340744833 True
-2750.1611441567 True
-2750.0719813883807 True
-2714.7754554002645 False
-2746.277283337242 False
-2749.6752339400173 True
-2740.383132665016 False
-2749.4180069812805 True
-2749.630684295231 True
-2748.6702479306823 True
-2727.15081636247 False
-2748.7968198645076 True
-2672.0326213632384 False
-2747.3194961909694 True
-2747.0116343229856 True
-2677.722100384228 False
-2675.9329047462224 False
-389.4738784285786 False
-2746.079569893212 False
-2747.182659741783 True
-2743.870896528837 True
-2660.9160052870498 False
-2743.9711014722843 True
-2743.976040611766 True
-2737.0363102503165 False
-2744.311962777113 True
-2750.4842955022577 True
-2387.082994936132 False
-2751.7915586312265 True
-2732.1981604326975 False
-2751.724435798512 True
-2751.7824319971533 True
-1861.1445037234364 False
-2751.5878791513514 True
-2751.6734179917144 True
-2750.3848390692237 True
-2738.2753982405416 False
-2743.0001960427776 False
-2749.7425967016334 False
-2750.561909188125 True
-2750.448036809393 True
-2749.891239151217 True
-2749.671810991115 True
-2749.720969466239 True
-2747.883911057629 True
-2719.2778079681034 False
-2747.6133983157824 True
-2744.5120457401035 False
-2732.782792534016 False
-2747.956098368454 True
-2748.1285001935476 True
-2748.1986947112246 True
-2748.227130577856 True
-1637.6193776470006 False
-2747.341680103097 False
-2744.313284276041 False
-2716.5895722450177 False
-2731.064000041742 False
-2739.9905053187945 False
-2658.052243820241 False
1419.0135022465456 False
-2748.2682582238726 True
-2750.189000802669 True
-2713.697632924538 False
-2700.4998394059935 False
-2736.520715257737 False
-2748.677475573069 True
-2748.6951278936285 True
-2746.6518700157158 False
-2736.486858734339 False
-1918.450572255102 False
-2748.9987893847738 True
-2617.19264578708 False
-2749.174278427929 True
-2745.7301500831354 False
-2748.872047683635 True
-2620.9256350203614 False
-2720.0597406592683 False
-2748.8744306045023 True
-2748.3202442808674 True
-1718.8647912710594 False
-2749.275424577931 True
-2749.1165621085224 True
-2633.467378465732 False
-2743.414256619025 False
-2749.469908085184 True
-2745.142395395662 False
-2745.8838068473387 False
-2651.412891172736 False
-2749.027922238807 True
-2749.9755156305205 True
-710.4797931098774 False
-2749.8143514388466 True
-2749.680621421436 True
-2749.5913179078025 True
-2749.6070140732922 True
-2749.297378948538 True
-2724.8210332730123 False
-2742.330617512393 False
-2715.3337910159603 False
-2748.742133458305 True
-2746.9596821930604 False
-2742.3925648636655 False
-2726.214908639324 False
-2747.1750867835076 True
-2683.971164982309 False
-2742.7068617030045 False
-2667.588470750877 False
-2747.100587222388 True
-2746.9894099197472 True
-2220.3828132618064 False
-2719.552307763717 False
-2746.285795482289 True
-2659.633074707521 False
-2746.9395941889647 True
-1789.586484892979 False
-2746.933629328168 True
-2747.1946399366866 True
-2748.2482417842093 True
-2741.156190995405 False
-2748.3216872841667 True
-2692.433020525085 False
-2480.3726783683346 False
-2748.3198756325232 True
-2748.2350612758796 True
-2747.7047338140565 True
-2723.6390609703963 False
-2747.061143234702 True
-2740.9092031813448 False
-2746.000803958662 False
-2744.4061558821513 False
-2747.104612771465 True
-2746.9467802558843 True
-2746.997103366588 True
-2746.9698262922875 True
-2739.123116989663 False
905.3679089887756 False
-2746.979571444769 True
-2746.9093758452577 True
-2589.8870690987687 False
-2746.8954062951325 True
-2740.4539845079053 False
-2523.8329027187456 False
-2705.9397464266 False
-2746.5446532924902 True
-2704.812563548644 False
-2746.499731110891 True
-2746.617739810371 True
-2745.5008628216383 False
-2745.5256094430456 False
-2734.437330127762 False
-2740.830932819399 False
-2745.684526767022 True
-2744.7685661020378 True
-1941.8708497889775 False
-2744.177199756245 True
-2744.0789529869353 True
-2744.337613063045 True
-2745.260002535522 True
-2745.2203904709295 False
-2744.7569538579182 True
-2738.9990897541466 False
-2744.6747247580424 True
-2744.914137193379 True
-2744.707466189031 True
-2744.4424498377466 True
-2733.5753039692227 False
-2744.9096805125673 True
-2743.9704837703734 True
-2725.1527053810605 True
-2725.8492027806924 True
-2729.0390316186877 True
-2636.286511239611 False
-2710.801723842035 False
-2728.134255165827 False
-2727.7574819490696 True
-2729.0381929360165 True
-2728.171856957629 True
-2728.166683540267 True
-2728.0369358024886 True
-2726.121723949902 False
-2723.9636172664314 False
-2712.769758113141 False
-2728.059743548512 True
-2728.462266475403 True
-2728.3651176305084 True
-2478.822800999085 False
-2728.055035139748 True
-2728.31095621509 True
-2728.3421251444124 True
-2723.0081266035327 False
-1869.5308404888785 False
-2728.1840963531417 True
-2620.0902789501497 False
-2721.9366997846832 True
-2721.5211641095048 True
-2491.9544211422312 False
-2720.4886583382477 True
-2728.011532261925 True
-2730.46181579453 True
-2730.442518159996 True
-2742.6439347502856 True
-2746.67131352961 True
-2746.982024415728 True
-2721.017846970861 False
-2748.0194853453518 True
-2748.2158085048372 True
-2748.2039859767215 True
-2748.160435594132 True
-2745.24475920749 False
-2750.3551693198574 True
-2739.0121709933387 False
-2741.9287452814506 False
-2748.4690945412253 False
-2749.514057056018 False
-2750.0258597130264 True
-2750.005921507648 True
-2750.2927119779597 True
-2714.394356081853 False
-2750.228124986392 True
-2749.980822657549 True
-2750.0216186444536 True
-2750.021891139584 True
-2749.2634822183427 True
-2749.0493502668933 True
-2730.637405338028 False
-2665.6917751505453 False
-2736.986048902335 False
2402.4352483338994 False
-2739.5733942833936 False
-2747.1865932148457 True
-2746.3645699438216 True
-1866.0886044435806 False
-2739.820551905838 False
-2746.044334491492 False
-2190.7041167002335 False
-2741.5996739277653 False
-2745.4851678694354 True
-2722.3210044526713 False
-2744.753302508896 True
-2589.376256408379 False
-2737.92634169491 False
-2744.2452416610213 True
-2655.8138935630427 False
-2746.2197318332246 True
-2745.9477492852266 False
-2745.773421699122 True
-2743.0143702436258 False
-2746.213090867487 True
-2746.1197462536757 True
-2731.1072155373236 False
-2740.304210712602 False
-2746.1899228419807 True
-2745.4912669411233 True
-2747.2507584617265 True
234.80072142312798 False
-2747.0619526231603 True
-2725.6692642295543 False
-2747.9701607602583 True
-2746.128170462792 True
-2748.452687978768 True
-2734.492617456596 False
-2748.461465525579 True
-2697.205022732955 False
-2746.2184867516016 True
-2745.9880173842766 True
-2744.3372675385954 False
-2744.5608338224833 False
-2670.365003213763 False
-2712.375582782849 False
-2745.7863708705745 True
-2746.8433072551843 True
2448.100165944412 False
-2584.3935107387133 False
-2737.631600660923 False
-2746.909219136005 True
-2747.2740101511836 True
-2725.0229535027825 False
-2747.375556212042 True
-2694.763567668074 False
-2740.369254261602 False
-2743.6681754058045 False
-2748.3758360572688 True
-2747.246880436892 True
-2746.8580689444466 True
-2746.2103398795484 False
-2229.8317155342565 False
2971.2970072565013 False
-2746.843177492396 True
-2747.0668570533535 True
-2746.99919931186 True
-2703.3869194962954 False
-2742.901161706009 False
-2747.1770829320626 True
-2747.241425665804 True
-2738.103903261042 False
-2747.36106773007 True
-2747.032431791559 True
-2747.4341782484676 True
-2747.491712628165 True
-2747.252765851217 True
-2748.307190746489 True
-2750.041660801388 True
-2747.847988075773 True
-2747.088607638615 True
-2749.2147263189977 True
-2750.248861379204 True
-2644.9275657521207 False
-2747.8746418351175 False
-2749.0558785315984 True
-2747.17135098538 True
-2747.078777613741 True
-2741.092012977037 False
-2746.843441751055 True
-2744.7199887197685 True
-2743.648714108821 True
-2743.837105174152 True
-2744.0104298260635 True
-2746.0537082301935 True
-2745.6542764104065 True
-2745.331007382317 True
-2745.349189536252 True
-2744.5528960625857 True
-2743.802129769316 True
-2555.576519609021 False
-2702.444064456306 False
-2744.6709387495125 True
-2590.102076691884 False
-2741.9158629097833 False
-2744.8717083893584 True
-2745.789258340926 True
-2746.036571668989 True
-2746.3842920760694 True
-2747.355602034648 True
-2745.7973584089464 False
-2745.3411512744815 True
-2745.192437588493 True
-2747.8821756122265 True
-2747.9832675986227 True
-2748.0176739339045 True
-2615.998651036259 False
-2737.4522330922196 False
-1901.2732242877587 False
-2746.5204669885434 True
-2747.9794650562226 True
-1942.0806636069833 False
-2747.9852310464303 True
-2747.6910033154086 True
-2743.195557832476 False
-2747.7143406274004 True
-2699.259802073309 False
-2731.6058556989724 False
-2745.779885747027 True
-1299.0155041274631 False
-2739.8061361135406 False
-2742.360029125006 True
-2743.3989966200534 True
-2747.09561934981 True
-2744.095281831526 False
-2399.459874798289 False
-2746.7766143695253 True
-2746.6161678623685 True
-2745.8008075858634 True
-2493.6770877093295 False
-2746.063371603981 True
-2746.673876905808 True
-2746.6690259903503 True
-2745.108797340871 True
-2573.51424897128 False
-2745.9614912209618 True
-2747.1825451306577 True
-2747.3961050878866 True
-2748.433217386519 True
-2749.8943606389125 True
-2750.0127722149414 True
-2728.9167761749914 False
-2743.304374393939 False
-2746.84685434431 True
-2746.5291767036106 True
-2745.420689124787 False
-2746.810347423438 True
-2732.931342825976 False
-2746.6623031279205 False
-2724.3120900322765 False
-2736.7289738450113 False
-2746.104576778919 True
-2745.6894943310494 True
-2750.144945484715 True
-2749.3890385957866 True
-2744.042729605103 False
-2595.4558504113643 False
-2749.661793509937 True
-2748.938887528128 True
-2726.0118415236648 False
-2726.207453574357 False
-2510.248367032157 False
-2747.816054162095 True
-2750.3902870656107 True
-2751.2218627789316 True
-2751.0100989146476 True
-2749.752447695471 True
-2749.549292745541 False
-2721.026159244588 False
-2748.9749613770596 True
-2749.172410391088 True
-2748.9776246183874 True
-2730.0555274284284 False
-2746.961502880223 True
-2732.947310533289 False
-2747.18657816826 True
-2748.040112803009 True
-2746.985138709205 True
-2719.4828710681336 False
-2746.6544483686343 True
-1929.4266312867157 False
-1468.8690983723523 False
-2744.6905147840293 False
-2706.5065932307093 False
-1909.3054849282585 False
-2731.050698359432 False
-2746.0664423191934 True
-2747.3292413611143 True
-2747.5735550800673 True
-2747.4860369291214 True
-2749.041366716259 True
-2746.868455066993 True
-2672.0652556480654 False
-2746.8061655488373 True
-2743.3155128255767 True
-2742.805987709072 True
-2740.371437166273 False
-2740.4551489405585 False
-2367.5199773356485 False
-2746.551612903907 True
-2743.9776503817243 True
-2746.2832940639673 True
-2716.797319728582 False
-2742.2074142115566 True
-2734.288406423169 False
-2742.5056751784646 True
-2743.198523781446 True
-2741.556752095052 False
-2741.7822141281736 True
-2745.7080699297594 True
-2744.992352360463 True
-2746.1391502900474 True
-2749.054226758885 True
-2612.5748372481016 False
-2742.272443644025 False
-2749.745316360822 True
-2749.7551274079565 True
-2749.7716226912353 True
-2749.0131735558216 True
-2748.2731936794817 True
-2722.8716683474754 False
-2749.0217320875363 True
-2748.9503321203993 True
-2719.731960945946 False
-2750.5048934450447 True
-2750.344944839801 True
-2748.6815755402404 True
-2530.0561484630957 False
-2749.6412145439167 True
-2749.6182004955112 True
-2740.115399317204 False
-2749.726862358053 True
-2698.7360744952707 False
-2749.5249931166504 True
-947.6864494852028 False
-2749.5410107495723 True
-2749.3911157140096 True
-2747.171557728971 False
-2748.9379946872236 False
-2749.5494170535976 True
-2726.110868166196 False
-2746.371804063326 False
-2749.9331381082443 True
-2678.001637349258 False
-2749.9621760433356 True
-2749.936410196096 True
-2749.729717556385 True
-2749.4546015839824 True
-2688.226071361058 False
-2750.877491500609 True
-2751.091938803996 True
-2746.451674861724 False
-2744.4780847985344 False
-2750.289801815012 False
-2750.59570740107 True
-2750.581164951151 True
-2741.6025664554636 False
-2603.8302400919724 False
-2749.4640102345575 True
-2747.5101867903204 True
-2747.4113721632466 True
-2744.6814003887794 False
-2747.163417247294 True
-2719.1361402521484 False
-2724.89400363662 False
-2541.918006585561 False
-2744.4306468424893 True
-2742.7643303404307 False
-2408.1395286429456 False
-2747.1078166749116 True
-2747.615240465703 True
-2748.045508985813 True
-2745.3396924971626 False
-2748.0378026962385 True
-1865.040169135206 False
-2747.675910796957 True
-2136.4341676432505 False
-2747.0848348069635 True
-2746.5317940696896 True
-2746.624994299431 True
-2570.7907521019292 False
-2679.64796127636 False
-2732.9470350725105 False
-2553.3352637867024 False
-2746.5756454059465 True
-2622.688515770135 False
-2746.747153738901 True
-2746.23634243196 False
-2741.7004921057364 False
-2748.124487910388 True
-2750.8565834517303 True
-2751.5192917047866 True
-2747.7716936939846 False
-2751.8898503955447 True
-2751.6525395226395 True
-2748.917289856947 True
-2751.7087995099973 True
-2751.147417730842 True
-2735.989823704373 False
-2741.8775680297936 False
-2751.2844367741654 True
-2642.4080559522768 False
-2748.6483702721125 True
-2748.3760439126013 False
-2734.6901692037895 False
-2747.6208086356405 True
-2747.504197742783 True
-2746.0216206356686 True
-2741.258776997227 False
-2745.733349411626 True
-2746.068630344205 True
-2731.4409240166906 False
-2744.5074142902095 False
-2331.4290370807316 False
-2717.8823412759493 False
-2746.7171575339585 True
-2741.623533673474 False
-2702.7690206903385 False
-2736.0048750631 True
-2735.391753914072 True
-2735.373272810916 True
-2736.5676778094444 True
-2735.429572795943 True
-2735.3052477538645 True
-2733.331641769642 True
-2708.87665026406 False
-2728.3863023078793 False
-2731.2247492875135 False
-2733.413909397399 True
-2488.588179764446 False
-2734.639880534879 True
-2735.521634147957 True
-2502.357185963293 False
-2745.488048454954 True
-2744.756625589106 False
-2737.9453738587185 False
-2741.295351730637 True
-2710.9421666664125 False
-2740.2966377709545 True
-2717.3662806178236 False
-2735.4152720113943 False
-2518.7353434404013 False
-2042.5665821150417 False
-2740.2969290132996 True
-2636.8388618159406 False
-2741.1777161713458 True
-2741.082677402051 True
-2741.597197094578 True
-2741.3820051539956 True
-2741.5390192151403 True
-2742.2497514783754 True
-1933.1869724964597 False
-2739.8979446586836 False
-2742.9533458927904 True
-2743.1574246246655 True
-2623.711435568951 False
-2741.9877490300705 True
-2741.3694277617915 True
-2737.9883544843574 False
-2741.3248456005526 True
2515.427170582474 False
-2741.811971297031 True
-2743.0474333145826 True
-2236.423977884955 False
-2741.7306337517566 True
-2742.793487106597 True
-2742.7290954241885 True
-2090.177256666467 False
-2730.6653676353785 False
-2742.720353108034 True
-2669.0644206657425 False
-1677.7743520053782 False
-2742.014907393428 True
-2741.6442187287794 True
-2740.961377990766 True
-2740.314976928487 True
-2736.0498096544625 False
-2740.791743081247 True
-2738.5576971670266 False
-2742.554449198076 True
-2744.1377180848376 True
-2607.2432184885847 False
-2744.26750418218 True
-2743.8968266277193 True
-2744.09417912618 True
-2729.39494855087 False
-2743.4188677385055 True
-1925.2279663249888 False
-2076.9983563637024 False
-2742.2715522254753 True
-2742.2827449814667 True
-2742.467546210557 True
-2742.2755424429565 True
-2740.4281178232245 False
-2741.620070325348 True
-1562.4304992677332 False
-2712.244175186806 False
-2736.706275981741 False
-2742.6619358775465 True
-1771.7366311862836 False
-2742.31559563398 True
-2739.14633508195 True
-2738.8614455764437 True
-2737.379801065505 False
-2728.152003370652 False
-2738.982588834316 True
-2740.453312029246 True
-2743.643247048985 True
-2744.137123435492 True
-1653.2237772658978 False
-2742.6969770825217 True
-2720.788579134838 False
-2479.9494553640247 False
-2732.300801066514 False
-2743.9394043472516 True
-1831.6461150480923 False
-2742.831420028043 False
-2744.0367568551956 True
-2740.47975029505 False
-2741.2469785109215 True
-2738.1654787827206 True
-2737.169504298605 False
-2729.8225844039184 False
-2736.879870010645 True
-2740.071150528564 True
-2741.7265280297765 True
-2171.924244896804 False
-2739.842382448524 True
-2636.706381122397 False
-2715.1441305476633 False
-2645.8222871001485 False
-2739.211219499902 True
-2739.704903616832 True
-2717.393603849158 False
-2713.4046325757704 False
-2739.7289920754333 True
-2498.145926329353 False
-2738.732180953701 True
-2737.88841511688 True
-2739.1285766384135 True
-2739.7672703352314 True
-2734.533868419191 False
-2745.674944494429 True
-2745.6507022296123 True
-2744.9479364110166 False
-2742.41770977875 True
-2719.597493176472 False
-2744.1587536489114 True
-2717.5968033579115 False
1599.3683841183238 False
-1842.0676255129606 False
-2733.979539325112 False
-2744.1237514041954 True
-2740.6048845333753 False
-2687.124395822677 False
-2742.9396072778663 True
-2743.470172333197 True
-2744.0320369566134 True
-2744.8368835039687 True
-2705.051810340413 False
-2730.6361981094065 False
-2742.503045396006 True
-2742.5424064844715 True
-2743.958664980186 True
-2377.8738188542925 False
-2743.823263688665 True
-2712.7227332434195 False
-2743.8789529292008 True
-2374.254847216439 False
-2730.928729743154 False
-2745.081815941432 True
-2746.1059657075707 True
-2742.3423606349484 True
-2703.7350041835584 False
-2741.767106445985 True
-2724.9549999656538 False
-2730.8858144936457 False
-2726.5350129883045 False
-2742.790743877653 True
-2719.4675662375685 False
-2742.4972514986707 True
-2744.2672409944266 True
-2679.526816946604 False
-2744.421541884351 True
-2709.9437941285933 False
-2741.8016352402615 True
-2741.7065374909785 True
-2745.730894646439 True
-2745.7034192867345 True
-2745.7563087037893 True
-2745.7458146752733 True
-2745.5194128946046 True
-2745.5452531377555 True
-2743.640440915321 False
-2732.6503518871764 False
-2745.5189069636745 True
-1921.2451570475162 False
-2745.4802292519075 True
-2742.8307915637383 True
-2744.928443489664 True
-2747.266722469823 True
-2747.0197621403795 True
-2749.7239177941683 True
-2749.712650375051 True
-2749.7793437428877 True
-2749.243580827468 True
-2745.6293640648337 True
-2746.108330385979 True
-2743.352896356012 True
-2749.212970758848 True
-2742.616961936805 True
-2739.8834292424585 True
-2742.996580649562 True
-2740.4546755359206 False
-2741.3687485372516 True
-2742.1982274375164 True
-2741.0293303449957 True
-2745.719620242473 True
-2747.3259565556805 True
-2747.0012765839147 True
-2336.6387922072313 False
-2744.45665851021 True
-2744.25153664339 True
-2713.398418665483 False
-2743.588965078259 True
-2743.1929940106716 False
-1347.2303701284848 False
-2740.3077188725943 True
-2741.0330935507377 True
-1228.3962379446039 False
-2722.337126870142 False
-2729.512018230116 False
-2566.2971403281535 False
-2727.841132657988 False
-2739.9434102627038 True
-2741.659418120947 True
-2741.8050756440057 True
-2741.3059516825074 True
-2744.544138079769 True
-2723.280476905367 False
-2744.750149248995 True
-2744.653393209918 True
-2743.883263602736 True
-2745.7485698713285 True
-2604.44382572685 False
-2748.267300435271 True
-2746.8673150404456 True
-2745.0215743684803 True
-2743.8858638309043 True
-2738.374006882863 False
-2740.8903875600095 False
-2739.7456035112978 True
-2714.015954704591 False
-2652.7132659052304 False
2927.520542012301 False
-2732.688271991198 False
-2399.188345854615 False
-2727.2064880903963 False
-2737.5633565202893 True
-2737.446651893613 True
-2740.403151720229 True
-2746.9192228404318 True
-2730.5287033124687 False
-2746.8621575094526 True
-2749.1718961490933 True
-2707.8957733572574 False
-2032.6321408966098 False
-2749.21760831426 True
-2749.1790479622564 True
1905.3847055728236 False
-2748.461916291112 True
-2748.088073911826 True
-2747.7161097309627 False
-1941.0063934026305 False
-2748.069106113965 True
-2502.617222008832 False
-2709.185397371579 False
-2727.176153801002 False
-2747.448656913349 True
-2211.1772079151024 False
-2747.72593422161 True
-2746.9865477849253 True
-2746.6567935237645 True
-2746.9869635206906 True
-2743.792320943553 False
-2746.8024486273616 True
-2729.184667471375 False
-2746.77257881967 True
-2716.4889377026448 False
-2747.3474768645588 True
-2715.8342938017113 False
-2708.9646628057308 False
-2731.379830052257 False
-2747.424526356595 True
-2749.7349006150052 True
-2749.643089502561 True
-2749.240909812802 True
-2747.582903792465 True
-2746.239150466236 True
-2738.0834231592785 False
-2747.1908754630285 True
-2703.715477991985 False
-2746.2756089029403 True
-2745.9267107303053 True
-2746.8564190521643 True
-2742.8460032711623 True
-2746.704780078544 True
-2747.3991011926178 True
-2747.2946951897084 True
-2747.18152862931 True
-2748.8983691903886 True
-2276.5579821002784 False
-2749.1006017222912 True
-2746.6402702539153 False
-2669.4649736194 False
-2696.6227742129236 False
-2748.9237782798136 True
-2733.9265089530427 False
-2748.972779885591 True
-2747.0686368243746 True
-2747.781828007552 True
-2742.217504738477 False
-2721.308371235548 False
-2747.019415062392 True
-2747.3625252914394 True
-2745.25296854076 False
-2744.305478938624 True
-2742.88714260449 False
-2564.7725085539028 False
-2737.7533801297523 False
-2745.43204748085 True
-2745.3299369100373 True
-2745.2238815145506 True
-189.7307364785162 False
-2727.2496435518897 False
-2731.168966643054 False
-2745.339372496091 True
-2683.7942521605883 False
-2748.3278493086896 True
-2748.373207493757 True
-2737.666643469779 False
-2748.2951889409146 True
-2748.292195152047 True
-2710.618908078785 False
-2749.238126047017 True
-2578.6296178110665 False
-2727.7918054217835 False
-2738.7483982457043 False
-2647.846906437648 False
-2744.9989531504534 False
-2722.7102623710844 False
-2746.0507029819128 False
-2408.5090660996 False
-2748.7722752496056 True
-2748.442432207359 True
-2747.1239502655676 True
-2747.106712486066 True
-2740.3395494208685 True
-2616.4952678027803 False
-2713.686321144562 False
-2739.1821880482025 True
-2731.138560693493 False
-2406.549529538545 False
-2323.3836440878963 False
-2736.346598480001 True
-2735.7967778327666 True
-2735.8625233548546 True
-2729.022793492233 False
-2741.731645611791 True
-2739.2895789662143 False
-2739.98644242138 True
-2739.86635825023 True
-2743.0811752633044 True
-2746.3744007134674 True
-2694.200710845717 False
-2741.993726833998 False
-2746.9051541493395 True
-2581.3925135638688 False
-2746.9051541493395 True
-2747.044880863276 True
-2745.8222054170938 True
-2746.5894104010426 True
-2746.3750281949847 True
-2728.8773866193187 False
-2747.8422555914312 True
-2746.8382068462824 True
-2664.4274366676946 False
-2748.6640030176172 True
-2748.419160812238 True
-2733.66645088808 False
-2581.6933521014157 False
-2749.5016478129137 True
-2748.0018816143206 False
-2725.4657201721275 False
-2750.2682179234885 True
-2629.588755649009 False
-2746.866622017395 True
-2746.4982767510564 True
-2747.8968935363196 True
-2747.4816721644484 True
-2746.76123606369 True
-2747.744915136512 True
-2747.7691426521633 True
-2748.2409175613666 True
-2749.0041401258827 True
-2750.049640867335 True
-2744.842714174698 False
-2750.8846656685487 True
-2750.9323884784308 True
-2639.8303209007936 False
-2507.0028786012776 False
-2748.599397045539 True
-2747.856869292936 True
-2618.978045380578 False
-2671.1768384326233 False
-2740.6052342849807 False
-2748.2030196891606 True
-2747.8811221413607 True
-2734.988234739761 False
-2747.531239666724 True
-2746.160708727795 True
-2696.984461964384 False
-1790.9042571294183 False
-2745.131458097548 False
-2738.026509010797 False
-2744.849741385205 False
-2748.869131712802 True
-2748.651559727169 True
-2748.9106302819587 True
-2710.749726810053 False
-1850.248279167417 False
-2749.0494623271757 True
-2750.192341275171 True
-2749.5887428767833 True
-2732.437213474115 False
-2748.7131403610224 False
-2749.7944849532905 True
-1930.6491533736757 False
-2747.4791713096515 False
-2750.9300058024332 True
-2672.73869893402 False
-2589.980219426009 False
-2750.87961021549 True
-2745.382718468612 -2752.20685277433

Were we able to improve the energy just from using sugarBB on this glycan tree?

Conclusion

This has covered most of the current RosettaCarbohydrate components you may find useful. The next tutorial will build on these components and use new movers that encorporate them for modeling and design.

In [ ]: