This notebook contains material from PyRosetta; content is available on Github.

Point Mutation Scan

Keywords: FastRelax, ResidueSelector, NeighborhoodResidueSelector, TaskFactory, TaskOperation, RestrictToRepackingRLT, RestrictAbsentCanonicalAASRLT, NoRepackDisulfides, OperateOnResidueSubset, RigidBodyTransMover, ggplot2

Overview

The purpose of this section is to create a protocol using what you have learned in the previous sections. In this tutorial, we will prepare an antibody-antigen bound structure, make point mutations on the antibody, records changes in binding enregy, and generate a heatmap demonstrating energy differences. This method is widely used in antibody interface design for either improving binding affinity or expanding the binding range.

Protocol

The whole protocol is broken down by eight steps.

Step 1. Prepare the structure with FastRelax()

Step 2. Write the function to perform the mutation PackMover()

Step 3. Write the function to unbind the antibody-antigen bound structure unbind()

Step 4. Write the function to get wildtype amino acid

Step 5. Write the function to properly mutate and pack a specific residue and output energy metrics

Step 6. Loop through interface positions mutating them into 20 amino acids with output files

Step 7. Summarize all input files for binding energy analysis

Section Contributors:

Yuanhan Wu (The Wistar Institute)

Daniel Kulp (The Wistar Institute)

Jared Adolf-Bryfogle (Scripps; Institute for Protein Innovation)

Ajasja Ljubetič (University of Washington)

Set up notebook

In [13]:
# Notebook setup
import sys
if 'google.colab' in sys.modules:
    !pip install pyrosettacolabsetup
    import pyrosettacolabsetup
    pyrosettacolabsetup.mount_pyrosetta_install()
    print ("Notebook is set for PyRosetta use in Colab.  Have fun!")

Make sure you are in the directory with the pdb files:

cd google_drive/My\ Drive/student-notebooks/

Loading structures

In [14]:
from pyrosetta import * 
init()
pose = pose_from_pdb("inputs/1jhl.clean.pdb")
testPose = Pose()
testPose.assign(pose)
print(testPose)
PyRosetta-4 2019 [Rosetta PyRosetta4.Release.python36.mac 2019.39+release.93456a567a8125cafdf7f8cb44400bc20b570d81 2019-09-26T14:24:44] retrieved from: http://www.pyrosetta.org
(C) Copyright Rosetta Commons Member Institutions. Created in JHU by Sergey Lyskov and PyRosetta Team.
core.init: Checking for fconfig files in pwd and ./rosetta/flags
core.init: Reading fconfig.../Users/jadolfbr/.rosetta/flags/common
core.init: 
core.init: 
core.init: Rosetta version: PyRosetta4.Release.python36.mac r233 2019.39+release.93456a567a8 93456a567a8125cafdf7f8cb44400bc20b570d81 http://www.pyrosetta.org 2019-09-26T14:24:44
core.init: command: PyRosetta -ex1 -ex2aro -database /Users/jadolfbr/Library/Python/3.6/lib/python/site-packages/pyrosetta-2019.39+release.93456a567a8-py3.6-macosx-10.6-intel.egg/pyrosetta/database
basic.random.init_random_generator: 'RNG device' seed mode, using '/dev/urandom', seed=-323604717 seed_offset=0 real_seed=-323604717
basic.random.init_random_generator: RandomGenerator:init: Normal mode, seed=-323604717 RG_type=mt19937
core.import_pose.import_pose: File 'inputs/1jhl.clean.pdb' automatically determined to be of type PDB
core.io.pdb.pdb_reader: Parsing 0 .pdb records with unknown format to search for Rosetta-specific comments.
core.conformation.Conformation: Found disulfide between residues 23 88
core.conformation.Conformation: current variant for 23 CYS
core.conformation.Conformation: current variant for 88 CYS
core.conformation.Conformation: current variant for 23 CYD
core.conformation.Conformation: current variant for 88 CYD
core.conformation.Conformation: Found disulfide between residues 130 204
core.conformation.Conformation: current variant for 130 CYS
core.conformation.Conformation: current variant for 204 CYS
core.conformation.Conformation: current variant for 130 CYD
core.conformation.Conformation: current variant for 204 CYD
core.conformation.Conformation: Found disulfide between residues 230 351
core.conformation.Conformation: current variant for 230 CYS
core.conformation.Conformation: current variant for 351 CYS
core.conformation.Conformation: current variant for 230 CYD
core.conformation.Conformation: current variant for 351 CYD
core.conformation.Conformation: Found disulfide between residues 254 339
core.conformation.Conformation: current variant for 254 CYS
core.conformation.Conformation: current variant for 339 CYS
core.conformation.Conformation: current variant for 254 CYD
core.conformation.Conformation: current variant for 339 CYD
core.conformation.Conformation: Found disulfide between residues 288 304
core.conformation.Conformation: current variant for 288 CYS
core.conformation.Conformation: current variant for 304 CYS
core.conformation.Conformation: current variant for 288 CYD
core.conformation.Conformation: current variant for 304 CYD
core.conformation.Conformation: Found disulfide between residues 300 318
core.conformation.Conformation: current variant for 300 CYS
core.conformation.Conformation: current variant for 318 CYS
core.conformation.Conformation: current variant for 300 CYD
core.conformation.Conformation: current variant for 318 CYD
PDB file name: inputs/1jhl.clean.pdb
Total residues: 353
Sequence: DIELTQSPSYLVASPGETITINCRASKSISKSLAWYQEKPGKTNNLLIYSGSTLQSGIPSRFSGSGSGTDFTLTISSLEPEDFAMYICQQHNEYPWTFGGGTKLEIKRQVQLQQSGAELVRPGASVKLSCKASGYTFISYWINWVKQRPGQGLEWIGNIYPSDSYTNYNQKFKDKATLTVDKSSSTAYMQLSSPTSEDSAVYYCTRDDNYGAMDYWGQGTTVTVKVYGRCELAAAMKRMGLDNYRGYSLGNWVCAAKFESNFNTGATNRNTDGSTDYGILQINSRWWCNDGRTPGSKNLCHIPCSALLSSDITASVNCAKKIVSDGDGMNAWVAWRKHCKGTDVNVWIRGCRL
Fold tree:
FOLD_TREE  EDGE 1 108 -1  EDGE 1 109 1  EDGE 109 224 -1  EDGE 1 225 2  EDGE 225 353 -1 

Step 1. Prepare the starting structure with FastRelax()

Properly relaxing a structure is crucial in design with Rosetta. A non relaxed structure may not overcome bad global energy well and therefore skew the following analysis on binding energy.

A FastRelax() is used to relax the structrue. While we want to put the sturcture in its lowest energy state, we want to keep the backbone information from the crystal structure as much as possible (lowest RMSD). Therefore, we apply constrain_relax_to_start_coords(True) to FastRelax().

Since FastRelax() is taking up a huge amount of resource, running it seems to crash the notebook, we commented out the "apply" part (the part that perform the relax) and print out the relaxMover() instead. We uploaded the relaxed structure to the input folder for furthre analysis.

Coordinate constrained relax is a general prep. For a more advanced version of this preparation method, see the pareto-optimal method by Nivon, Morreti, and Baker

In [15]:
from pyrosetta.rosetta.protocols.relax import FastRelax

relax = FastRelax()
scorefxn = get_fa_scorefxn()
relax.set_scorefxn(scorefxn)
relax = rosetta.protocols.relax.FastRelax()
relax.constrain_relax_to_start_coords(True)
print(relax)
#relax.apply(testPose)
#testPose.dump_pdb('test.relax.pdb')
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
<pyrosetta.rosetta.protocols.relax.FastRelax object at 0x13800cc70>

Writing Function in Python

Functions are good ways to organize your code. Starting from this section I am introducing serveral functions to facilitate the protocol.

To define a function in python, a "def" key word is used. A function can either returns a value or simply executing code blocks. A defined function can be called in main function or other sections of code too.

Step 2. Write the function for mutation

This function utilizes the ResidueSelectorMover() as demonstrated by previous tutorials. Mutated position is allowed to be designed and repacked while the neighborhood residues are limited to repacked only. The final mutation will be performed with a PackMover().

In [16]:
from pyrosetta.rosetta.core.pack.task import *
from pyrosetta.rosetta.protocols import *
from pyrosetta.rosetta.core.select import *

def pack(pose, posi, amino, scorefxn):

    # Select Mutate Position
    mut_posi = pyrosetta.rosetta.core.select.residue_selector.ResidueIndexSelector()
    mut_posi.set_index(posi)
    #print(pyrosetta.rosetta.core.select.get_residues_from_subset(mut_posi.apply(pose)))

    # Select Neighbor Position
    nbr_selector = pyrosetta.rosetta.core.select.residue_selector.NeighborhoodResidueSelector()
    nbr_selector.set_focus_selector(mut_posi)
    nbr_selector.set_include_focus_in_subset(True)
    #print(pyrosetta.rosetta.core.select.get_residues_from_subset(nbr_selector.apply(pose)))

    # Select No Design Area
    not_design = pyrosetta.rosetta.core.select.residue_selector.NotResidueSelector(mut_posi)
    #print(pyrosetta.rosetta.core.select.get_residues_from_subset(not_design.apply(pose)))

    # The task factory accepts all the task operations
    tf = pyrosetta.rosetta.core.pack.task.TaskFactory()

    # These are pretty standard
    tf.push_back(pyrosetta.rosetta.core.pack.task.operation.InitializeFromCommandline())
    tf.push_back(pyrosetta.rosetta.core.pack.task.operation.IncludeCurrent())
    tf.push_back(pyrosetta.rosetta.core.pack.task.operation.NoRepackDisulfides())

    # Disable Packing
    prevent_repacking_rlt = pyrosetta.rosetta.core.pack.task.operation.PreventRepackingRLT()
    prevent_subset_repacking = pyrosetta.rosetta.core.pack.task.operation.OperateOnResidueSubset(prevent_repacking_rlt, nbr_selector, True )
    tf.push_back(prevent_subset_repacking)

    # Disable design
    tf.push_back(pyrosetta.rosetta.core.pack.task.operation.OperateOnResidueSubset(
        pyrosetta.rosetta.core.pack.task.operation.RestrictToRepackingRLT(),not_design))

    # Enable design
    aa_to_design = pyrosetta.rosetta.core.pack.task.operation.RestrictAbsentCanonicalAASRLT()
    aa_to_design.aas_to_keep(amino)
    tf.push_back(pyrosetta.rosetta.core.pack.task.operation.OperateOnResidueSubset(aa_to_design, mut_posi))
    
    # Create Packer
    packer = pyrosetta.rosetta.protocols.minimization_packing.PackRotamersMover()
    packer.task_factory(tf)

    #Perform The Move
    if not os.getenv("DEBUG"):
      packer.apply(pose)

#Load the previously-relaxed pose.
relaxPose = pose_from_pdb("inputs/1jhl.relax.pdb")

#Clone it
original = relaxPose.clone()
scorefxn = get_score_function()
print("\nOld Energy:", scorefxn(original),"\n")
pack(relaxPose, 130, 'A', scorefxn)
print("\nNew Energy:", scorefxn(relaxPose),"\n")

#Set relaxPose back to original
relaxPose = original.clone()
core.import_pose.import_pose: File 'inputs/1jhl.relax.pdb' automatically determined to be of type PDB
core.io.pdb.pdb_reader: Parsing 359 .pdb records with unknown format to search for Rosetta-specific comments.
core.conformation.Conformation: Found disulfide between residues 230 351
core.conformation.Conformation: current variant for 230 CYS
core.conformation.Conformation: current variant for 351 CYS
core.conformation.Conformation: current variant for 230 CYD
core.conformation.Conformation: current variant for 351 CYD
core.conformation.Conformation: Found disulfide between residues 130 204
core.conformation.Conformation: current variant for 130 CYS
core.conformation.Conformation: current variant for 204 CYS
core.conformation.Conformation: current variant for 130 CYD
core.conformation.Conformation: current variant for 204 CYD
core.conformation.Conformation: Found disulfide between residues 23 88
core.conformation.Conformation: current variant for 23 CYS
core.conformation.Conformation: current variant for 88 CYS
core.conformation.Conformation: current variant for 23 CYD
core.conformation.Conformation: current variant for 88 CYD
core.conformation.Conformation: Found disulfide between residues 254 339
core.conformation.Conformation: current variant for 254 CYS
core.conformation.Conformation: current variant for 339 CYS
core.conformation.Conformation: current variant for 254 CYD
core.conformation.Conformation: current variant for 339 CYD
core.conformation.Conformation: Found disulfide between residues 288 304
core.conformation.Conformation: current variant for 288 CYS
core.conformation.Conformation: current variant for 304 CYS
core.conformation.Conformation: current variant for 288 CYD
core.conformation.Conformation: current variant for 304 CYD
core.conformation.Conformation: Found disulfide between residues 300 318
core.conformation.Conformation: current variant for 300 CYS
core.conformation.Conformation: current variant for 318 CYS
core.conformation.Conformation: current variant for 300 CYD
core.conformation.Conformation: current variant for 318 CYD
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015

Old Energy: -1056.7706161583792 

protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 1129 rotamers at 23 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph

New Energy: -1057.3165843559357 

Step 3. unbind()

This function is for binding energy analysis. To compute a binding energy, we need to score the total energy of a bound state structure, separate (unbind) the antigen and antibody and then score the unbound state total energy. The binding energy is given by bound energy - unbound energy. You can also use the InterfaceAnalyzerMover (IAM) , located in rosetta.protocols.analysis.

  • Benefits to unbind over IAM:

    • Quicker
    • Simpler
  • Disadvantages to unbind over IAM:

    • Specific foldtree needs to used, with a specific jump. For IAM - it is now foldtree independent, so you only need to know the chainIDs on each side of the interface.
In [17]:
from pyrosetta.rosetta.protocols import *

def unbind(pose, partners):
    STEP_SIZE = 100
    JUMP = 2
    docking.setup_foldtree(pose, partners, Vector1([-1,-1,-1]))
    trans_mover = rigid.RigidBodyTransMover(pose,JUMP)
    trans_mover.step_size(STEP_SIZE)
    trans_mover.apply(pose)


##Reset the original pose
relaxPose = original.clone()

scorefxn = get_score_function()
bound_score = scorefxn(relaxPose)
print("\nBound State Score",bound_score,"\n")
unbind(relaxPose, "HL_A")
unbound_score = scorefxn(relaxPose)

print("\nUnbound State Score", unbound_score,"\n")
print('dG', bound_score - unbound_score, 'Rosetta Energy Units (REU)')
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015

Bound State Score -1056.7706161583792 

protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -24.7339 16.9267 23.6626
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517

Unbound State Score -998.7222028352029 

dG -58.048413323176305 Rosetta Energy Units (REU)

Step 4. wildtype()

An important metrics for evaluating binding improvement is the ratio of mutant binding energy to wild type binding energy. This function returns the wild type amino acids in a given position.

In [34]:
def wildtype(aatype = 'AA.aa_gly'):
    AA = ['G','A','L','M','F','W','K','Q','E','S','P'
            ,'V','I','C','Y','H','R','N','D','T']

    AA_3 = ['AA.aa_gly','AA.aa_ala','AA.aa_leu','AA.aa_met','AA.aa_phe','AA.aa_trp'
            ,'AA.aa_lys','AA.aa_gln','AA.aa_glu', 'AA.aa_ser','AA.aa_pro','AA.aa_val'
            ,'AA.aa_ile','AA.aa_cys','AA.aa_tyr','AA.aa_his','AA.aa_arg','AA.aa_asn'
            ,'AA.aa_asp','AA.aa_thr']

    for i in range(0, len(AA_3)):
        if(aatype == AA_3[i]):
            return AA[i]

print(wildtype(str(relaxPose.aa(130))))
C

Setp 4a. Exploration.

We can also use some utility functions instead of this function.

We can use the sequence STRING returned. Note that strings are indexed at 0 in Rosetta.

In [28]:
print(relaxPose.sequence())
print("\n",relaxPose.sequence()[129])
DIELTQSPSYLVASPGETITINCRASKSISKSLAWYQEKPGKTNNLLIYSGSTLQSGIPSRFSGSGSGTDFTLTISSLEPEDFAMYICQQHNEYPWTFGGGTKLEIKRQVQLQQSGAELVRPGASVKLSCKASGYTFISYWINWVKQRPGQGLEWIGNIYPSDSYTNYNQKFKDKATLTVDKSSSTAYMQLSSPTSEDSAVYYCTRDDNYGAMDYWGQGTTVTVKVYGRCELAAAMKRMGLDNYRGYSLGNWVCAAKFESNFNTGATNRNTDGSTDYGILQINSRWWCNDGRTPGSKNLCHIPCSALLSSDITASVNCAKKIVSDGDGMNAWVAWRKHCKGTDVNVWIRGCRL

 C

Now lets get some information fromt the ResidueType object that holds chemical information.

In [29]:
print(relaxPose.residue_type(130))
CYS:disulfide (CYS, C):
Base: CYS
 Properties: POLYMER PROTEIN CANONICAL_AA SC_ORBITALS METALBINDING DISULFIDE_BONDED ALPHA_AA L_AA
 Variant types: DISULFIDE
 Main-chain atoms:  N    CA   C  
 Backbone atoms:    N    CA   C    O    H    HA 
 Side-chain atoms:  CB   SG  1HB  2HB 

Finally, lets get the residue from the type

In [32]:
resT = relaxPose.residue_type(130)

print(resT.base_name())
print(resT.name3())
print(resT.name1())
CYS
CYS
C

Step 5. Integrate functions for mutate and output

In [35]:
def mutate(pose, posi, amino, partners):
    #main function for mutation
    CSV_PREFIX = 'notec'
    PDB_PREFIX = 'notep'

    #Initiate test pose
    testPose = Pose()
    testPose.assign(pose)

    #Initiate energy function
    scorefxn = get_fa_scorefxn()
    unbind(testPose, partners)
    native_ub = scorefxn(testPose)
    testPose.assign(pose)
    
    #Variables initiation
    content = ''
    name = CSV_PREFIX + str(posi)+str(amino) + '.csv'
    pdbname = PDB_PREFIX + str(posi)+str(amino) + '.pdb'
    wt = wildtype(str(pose.aa(posi)))

    pack(testPose, posi, amino, scorefxn)
    testPose.dump_pdb(pdbname)
    bound = scorefxn(testPose)
    unbind(testPose, partners)
    unbound = scorefxn(testPose)
    binding = unbound - bound
    testPose.assign(pose)

    if (wt == amino):
        wt_energy = binding
    else:
        pack(testPose, posi, wt, scorefxn)
        wtbound = scorefxn(testPose)
        unbind(testPose, partners)
        wtunbound = scorefxn(testPose)
        wt_energy = wtunbound - wtbound
        testPose.assign(pose)

    content=(content+str(pose.pdb_info().pose2pdb(posi))+','+str(amino)+','
              +str(native_ub)+','+str(bound)+','+str(unbound)+','+str(binding)+','
              +str(wt_energy)+','+str(wt)+','+str(binding/wt_energy)+'\n')

    f = open(name,'w+')
    f.write(content)
    f.close()

mutate(relaxPose, 130, 'A', 'HL_A')
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 1129 rotamers at 23 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.443 35.3926 153.839
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 1129 rotamers at 23 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.443 35.3926 153.839

Step 6. Loop through interface positions

The following code loop through all heavy chain and light chain positions mutating them into all 20 amino acids. The actual run may again crash the notebook.

You may output the data however you wish. pose.scores() will have the data, maps and pandas Dataframes can also be used. Here, we will simply output energy information of each mutation in form of csv files and cat them into one file for future analysis. An output file is uploaded to the input folder for the R analysis.

In real work setting, parallelization can be achieve. Please see the PyRosetta in Parellel chapter. For this task, you not necessarily need to finish the whole loop. We have a finished version in the inputs folder.

In [41]:
#NOTE - This takes a very long time!!  
# You may skip this block to continue the tutorial with pre-configured outputs.
if not os.getenv("DEBUG"):
  for i in [92,85,68,53,5,45,44,42,32,31,22,108,100]:
    print("\nMutating Position: ",str(i),"\n")
    for j in ['G','A','L','M','F','W','K','Q','E','S','P','V','I','C','Y','H','R','N','D','T']:
      mutate(relaxPose, i, j, 'HL_A')
/Users/jadolfbr/Documents/Rosetta/PyRosetta.notebooks/notebooks/outputs/NNK_outputs

Mutating Position:  92 

core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 553 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.46 35.37 153.822
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 558 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3968 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 553 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.452 35.3806 153.83
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 558 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3968 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 553 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.424 35.4115 153.858
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 558 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3968 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 554 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.429 35.4024 153.854
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 558 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3968 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 555 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.419 35.4182 153.863
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 558 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3968 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 556 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.404 35.4248 153.879
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 558 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3968 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 554 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.412 35.4202 153.87
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 558 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3968 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 556 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.43 35.4017 153.852
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 558 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3968 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 555 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.437 35.3975 153.844
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 558 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3968 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 606 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.45 35.3847 153.832
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 558 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3968 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 553 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.444 35.3957 153.836
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 558 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3968 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 553 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.436 35.4004 153.846
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 558 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3968 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 553 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.429 35.4068 153.853
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 558 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3968 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 555 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.45 35.3849 153.832
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 558 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3968 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 558 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.415 35.4227 153.867
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 558 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3968 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 567 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.429 35.4067 153.853
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 558 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3968 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 555 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.406 35.4288 153.877
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 558 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3968 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 558 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3968 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 558 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.446 35.3881 153.835
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 558 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3968 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 570 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3941 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 558 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3968 153.841

Mutating Position:  85 

core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 346 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.415 35.3752 153.873
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 355 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 346 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.424 35.3789 153.863
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 355 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 348 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.446 35.398 153.834
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 355 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 355 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 348 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.457 35.3963 153.822
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 355 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 351 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.465 35.4247 153.809
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 355 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 361 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.456 35.4072 153.822
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 355 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 368 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.443 35.3935 153.839
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 355 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 360 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.387 153.843
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 355 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 399 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.427 35.3803 153.859
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 355 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 346 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3795 153.844
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 355 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 346 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3886 153.842
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 355 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 347 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.45 35.3939 153.83
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 355 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 351 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.426 35.3809 153.86
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 355 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 351 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.458 35.4028 153.82
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 355 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 368 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.446 35.3907 153.835
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 355 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 372 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.462 35.418 153.813
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 355 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 355 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.437 35.3843 153.846
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 355 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 353 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.428 35.3847 153.857
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 355 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 381 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.434 35.3861 153.85
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 355 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84

Mutating Position:  68 

core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 499 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 499 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.426 35.4069 153.857
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 499 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 500 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.376 35.434 153.911
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 499 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 506 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.387 35.4307 153.898
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 499 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 503 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.368 35.4325 153.92
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 499 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 506 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.345 35.4465 153.944
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 499 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 516 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.353 35.444 153.935
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 499 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 518 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.387 35.4245 153.899
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 499 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 511 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.397 35.422 153.887
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 499 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 549 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.42 35.4102 153.862
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 499 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 500 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.402 35.4162 153.882
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 499 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 499 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.394 35.4275 153.89
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 499 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 500 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.378 35.4356 153.907
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 499 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 504 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.42 35.4101 153.863
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 499 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 508 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.361 35.434 153.927
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 499 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 524 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.385 35.4251 153.901
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 499 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 521 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.339 35.45 153.951
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 499 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 509 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.403 35.4185 153.881
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 499 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 505 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.415 35.4125 153.869
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 499 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 534 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.404 35.4179 153.88
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 499 rotamers at 17 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84

Mutating Position:  53 

core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 333 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.453 35.4244 153.822
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 369 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3954 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 333 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.448 35.4129 153.83
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 369 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3954 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 335 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.426 35.3765 153.86
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 369 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3954 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 343 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.433 35.382 153.852
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 369 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3954 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 337 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.433 35.3607 153.854
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 369 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3954 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 342 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.41 35.3503 153.883
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 369 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3954 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 352 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.418 35.3668 153.871
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 369 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3954 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 358 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.436 35.3767 153.849
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 369 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3954 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 349 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.436 35.3931 153.846
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 369 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3954 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 368 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.445 35.4095 153.833
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 369 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3954 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 333 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.436 35.3998 153.845
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 369 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3954 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 333 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.436 35.3879 153.847
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 369 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3954 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 334 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.429 35.3765 153.857
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 369 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3954 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 338 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.447 35.408 153.832
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 369 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3954 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 342 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.432 35.3544 153.856
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 369 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3954 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 354 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.438 35.377 153.847
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 369 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3954 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 359 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.417 35.3495 153.875
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 369 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3954 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 342 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.438 35.3981 153.843
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 369 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3954 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 340 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.443 35.4045 153.837
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 369 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3954 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 369 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3954 153.841

Mutating Position:  5 

core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 259 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.452 35.3522 153.833
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 295 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 259 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.447 35.3703 153.837
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 295 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 262 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.43 35.4327 153.848
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 295 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 270 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.434 35.4183 153.846
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 295 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 263 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.428 35.4442 153.848
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 295 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 265 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.425 35.4771 153.848
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 295 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 281 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.429 35.4603 153.845
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 295 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 282 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.432 35.4206 153.847
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 295 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 272 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.438 35.4018 153.843
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 295 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 312 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.445 35.3759 153.838
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 295 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 259 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.437 35.4004 153.844
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 295 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 259 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.437 35.4085 153.844
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 295 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 261 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.43 35.4296 153.849
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 295 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 264 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.445 35.3775 153.838
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 295 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 268 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.426 35.4528 153.85
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 295 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 284 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.433 35.4218 153.845
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 295 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 286 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.422 35.478 153.851
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 295 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 270 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.439 35.3978 153.842
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 295 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 266 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3873 153.84
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 295 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 295 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841

Mutating Position:  45 

core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 585 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.425 35.4217 153.855
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 711 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 585 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.433 35.4117 153.848
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 711 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 616 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.454 35.3754 153.828
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 711 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 692 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.451 35.3808 153.831
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 711 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 640 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.485 35.3651 153.794
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 711 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 650 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.497 35.3418 153.783
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 711 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 820 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.466 35.3568 153.817
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 711 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 831 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.449 35.382 153.833
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 711 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 742 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.445 35.3921 153.837
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 711 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 746 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.435 35.4081 153.846
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 711 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 585 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.449 35.4013 153.831
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 711 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 587 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.449 35.3895 153.832
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 711 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 607 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.458 35.3775 153.823
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 711 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 638 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.435 35.4078 153.846
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 711 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 676 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.489 35.3598 153.79
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 711 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 832 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.473 35.3769 153.806
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 711 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 821 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.469 35.3417 153.815
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 711 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 711 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 635 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.437 35.4034 153.844
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 711 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 692 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3967 153.839
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 711 rotamers at 18 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84

Mutating Position:  44 

core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 381 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.415 35.3964 153.87
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 392 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 381 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.424 35.3941 153.86
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 392 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 382 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.457 35.3952 153.822
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 392 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 392 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3911 153.84
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 392 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 384 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.463 35.3989 153.815
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 392 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 386 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.474 35.4059 153.801
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 392 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 397 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.454 35.3936 153.825
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 392 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 414 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3941 153.839
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 392 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 402 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.393 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 392 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 416 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.431 35.3942 153.852
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 392 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 381 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.444 35.3894 153.838
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 392 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 383 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3886 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 392 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 383 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.449 35.3893 153.832
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 392 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 386 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.427 35.3936 153.857
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 392 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 388 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.466 35.4007 153.811
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 392 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 394 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.452 35.3965 153.828
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 392 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 406 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.462 35.4021 153.816
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 392 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 392 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 388 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.435 35.3946 153.848
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 392 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 416 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.435 35.392 153.848
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 392 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84

Mutating Position:  42 

core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 315 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.383 35.4516 153.899
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 338 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 315 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.397 35.4422 153.885
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 338 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 317 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.434 35.4089 153.846
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 338 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 325 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.423 35.4152 153.858
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 338 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 319 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.448 35.4022 153.831
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 338 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 321 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.467 35.3778 153.812
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 338 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 338 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 338 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.427 35.4151 153.854
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 338 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 328 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.417 35.4242 153.864
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 338 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 350 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.401 35.4391 153.88
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 338 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 315 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.422 35.4311 153.857
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 338 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 315 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.424 35.4212 153.856
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 338 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 316 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.438 35.4101 153.842
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 338 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 320 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.401 35.4391 153.881
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 338 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 324 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.453 35.3967 153.826
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 338 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 336 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.433 35.4145 153.847
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 338 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 339 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.447 35.3866 153.835
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 338 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 326 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.417 35.4281 153.864
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 338 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 322 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.407 35.4347 153.874
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 338 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 350 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.414 35.4284 153.866
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 338 rotamers at 11 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.3951 153.84

Mutating Position:  32 

core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 380 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.451 35.3922 153.829
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 380 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.444 35.3961 153.837
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 393 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.421 35.4027 153.863
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 452 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.428 35.4027 153.855
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 420 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.415 35.4007 153.869
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 422 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.411 35.3942 153.875
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 541 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.412 35.4087 153.872
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 545 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.425 35.3981 153.859
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 498 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.431 35.3983 153.851
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 380 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.428 35.4044 153.854
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 382 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.43 35.4019 153.852
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 397 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.423 35.4014 153.861
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 433 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 455 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.412 35.4002 153.873
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.424 35.4 153.86
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 514 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.414 35.4073 153.87
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 443 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.433 35.4 153.849
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 430 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.439 35.3975 153.843
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 487 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.436 35.4003 153.846
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 19 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84

Mutating Position:  31 

core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 534 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.509 35.4048 153.76
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 534 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.498 35.4043 153.773
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 534 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.465 35.3956 153.813
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 538 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.468 35.3984 153.809
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 534 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.45 35.4056 153.829
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 536 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.43 35.408 153.851
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.466 35.4021 153.81
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 540 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.476 35.4029 153.799
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 569 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.494 35.4046 153.777
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 534 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.478 35.4077 153.796
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 534 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.474 35.4022 153.801
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 534 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.461 35.4025 153.816
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 536 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.493 35.4038 153.779
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 537 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.444 35.4056 153.835
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 543 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.465 35.4058 153.811
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 543 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.43 35.3936 153.853
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 537 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.48 35.404 153.794
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 537 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.49 35.4026 153.783
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 569 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.481 35.4052 153.793
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 542 rotamers at 16 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3971 153.84

Mutating Position:  22 

core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 471 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.458 35.3767 153.824
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 482 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3953 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 471 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.451 35.3853 153.831
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 482 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3953 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 472 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.426 35.4069 153.856
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 482 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3953 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 482 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.433 35.4061 153.848
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 482 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3953 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 475 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.422 35.4056 153.86
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 482 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3953 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 478 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.406 35.4147 153.878
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 482 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3953 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 487 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.415 35.4186 153.868
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 482 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3953 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 489 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.43 35.4037 153.851
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 482 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3953 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 486 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.437 35.3985 153.844
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 482 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3953 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 524 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.449 35.3884 153.832
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 482 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3953 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 471 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.443 35.3984 153.838
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 482 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3953 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 471 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.435 35.4017 153.846
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 482 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3953 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 473 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.427 35.4105 153.855
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 482 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3953 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 476 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.448 35.3872 153.834
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 482 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3953 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 476 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.419 35.4068 153.864
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 482 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3953 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 494 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.431 35.4001 153.851
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 482 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3953 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 498 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.407 35.4258 153.875
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 482 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3953 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 482 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3953 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 478 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.445 35.3898 153.836
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 482 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3953 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 488 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3953 153.84
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 482 rotamers at 13 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.3953 153.841

Mutating Position:  108 

core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 79 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.376 35.4324 153.91
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 110 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 79 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.387 35.4301 153.898
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 110 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 81 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.424 35.4211 153.857
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 110 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 90 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.414 35.4242 153.867
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 110 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 82 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.426 35.4116 153.856
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 110 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 88 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.444 35.3974 153.837
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 110 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 100 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.439 35.412 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 110 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 104 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.413 35.416 153.87
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 110 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 93 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.408 35.426 153.875
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 110 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 132 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.391 35.4289 153.894
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 110 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 79 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.409 35.4367 153.871
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 110 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 80 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.41 35.4233 153.873
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 110 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 82 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.422 35.4199 153.859
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 110 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 84 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.39 35.4288 153.894
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 110 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 86 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.434 35.4195 153.845
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 110 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 98 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.414 35.4173 153.869
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 110 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 110 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 90 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.402 35.4245 153.882
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 110 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 85 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.395 35.4282 153.889
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 110 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 114 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.402 35.4258 153.881
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 110 rotamers at 6 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841

Mutating Position:  100 

core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 443 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3958 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 443 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.412 153.837
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 443 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3958 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 444 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.444 35.4684 153.827
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 443 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3958 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 452 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.4548 153.833
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 443 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3958 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 447 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.4784 153.827
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 443 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3958 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 447 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.438 35.5067 153.828
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 443 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3958 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 460 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.44 35.4932 153.827
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 443 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3958 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 472 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.4577 153.83
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 443 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3958 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 456 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.4433 153.832
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 443 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3958 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 478 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.4165 153.836
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 443 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3958 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 443 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.4343 153.835
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 443 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3958 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 445 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.445 35.4465 153.829
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 443 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3958 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 446 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.447 35.4656 153.824
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 443 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3958 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 448 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.4185 153.836
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 443 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3958 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 451 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.486 153.827
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 443 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3958 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 460 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.4583 153.831
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 443 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3958 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 463 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.439 35.5092 153.827
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 443 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3958 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 452 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.4372 153.833
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 443 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3958 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 448 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.442 35.4245 153.835
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 443 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3958 153.841
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3952 153.841
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 460 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating PDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.443 35.4346 153.833
protocols.minimization_packing.PackRotamersMover: [ WARNING ] undefined ScoreFunction -- creating a default one
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 443 rotamers at 15 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
protocols.moves.RigidBodyMover: Translate: Jump (before): RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -100.087 26.161 88.7517
protocols.moves.RigidBodyMover: Translate: Jump (after):  RT 0.552606 0.336448 0.762515 -0.674731 0.717663 0.172329 -0.489249 -0.609723 0.623597 -175.441 35.3958 153.841

Merging output csv files for binding energy analysis in R

Analysis of binding data

After gathering summarized binding energy information, we use pandas for filtering and visualization. We filtered out lower unbound energy structures, those that have higher unbound state total energy than native and make a heatmap from the filtered data. In case you don't want to finish the for loop at Step 8, we uploaded a finished version of merged output csv to the inputs folder named "note_output.csv".

In [42]:
#import modules need for analysis
import pandas as pd
%matplotlib inline
import matplotlib.pyplot as plt 
import seaborn as sns
In [45]:
csv_file_name = 'inputs/note_output.csv'
In [54]:
#Generating heatmaps

UNBOUND_CUTOFF = -995
RATIO_CUTOFF = 1.001

#load the data into a pandas dataframe
df = pd.read_csv(csv_file_name, names='Position Amino.Acid Native Bound Unbound Binding WT_Binding WT Ratio'.split(), index_col=False )
#Add wildtype AA to position (for display)
df['Position_WT_aa'] = df.Position + ' (' + df.WT  + ')' 

#filter values
df = df.query(f'Unbound<{UNBOUND_CUTOFF} and Ratio>{RATIO_CUTOFF}')

# convert from tidy format (https://en.wikipedia.org/wiki/Tidy_data) to a wider format
df = pd.pivot_table(df, values='Ratio', 
                     index=['Position_WT_aa'], 
                     columns='Amino.Acid')

#plot the heatmap
f, ax = plt.subplots(figsize=(10, 10))
sns.heatmap(df, cmap='coolwarm', linewidths= 1, linecolor='lightgray')
plt.xlabel('Amino acid mutation');
plt.ylabel('Position chain and wild type AA');
sns.set_context("talk") #make labels bigger

See Also

Note these may not be available in PyRosetta through code or even by xml (remodel), but they are extremely useful tools when doing denovo protein design - and you should be aware of them.

  • Parametric Design
    • Previous Workshop!
In [0]: